BLASTX nr result
ID: Lithospermum22_contig00008795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00008795 (432 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABL63118.1| AT-hook DNA-binding protein [Catharanthus roseus] 57 2e-06 >gb|ABL63118.1| AT-hook DNA-binding protein [Catharanthus roseus] Length = 293 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = -1 Query: 342 DPS-LIHGMPQNLLNSIQMPNEAYCATGRPPF 250 DPS L HGMP NLLNSIQ+PNEAY ATGRPPF Sbjct: 262 DPSALFHGMPPNLLNSIQLPNEAYWATGRPPF 293