BLASTX nr result
ID: Lithospermum22_contig00008523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00008523 (620 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI33305.3| unnamed protein product [Vitis vinifera] 80 3e-13 ref|XP_003635632.1| PREDICTED: U-box domain-containing protein 4... 80 3e-13 ref|XP_002528228.1| ubiquitin-protein ligase, putative [Ricinus ... 77 2e-12 ref|XP_003594249.1| U-box domain-containing protein [Medicago tr... 74 2e-11 ref|XP_004134799.1| PREDICTED: U-box domain-containing protein 4... 73 4e-11 >emb|CBI33305.3| unnamed protein product [Vitis vinifera] Length = 286 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = +2 Query: 14 RNLLVREGGIHPLVALSQNGSAKAKHKAETLLGYLREPRQEASTS 148 R LLVREGGI PLVALSQ G+A+AKHKAETLLGYLREPRQEASTS Sbjct: 240 RGLLVREGGIPPLVALSQTGTARAKHKAETLLGYLREPRQEASTS 284 >ref|XP_003635632.1| PREDICTED: U-box domain-containing protein 4-like [Vitis vinifera] gi|147866196|emb|CAN79837.1| hypothetical protein VITISV_007520 [Vitis vinifera] Length = 452 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = +2 Query: 14 RNLLVREGGIHPLVALSQNGSAKAKHKAETLLGYLREPRQEASTS 148 R LLVREGGI PLVALSQ G+A+AKHKAETLLGYLREPRQEASTS Sbjct: 406 RGLLVREGGIPPLVALSQTGTARAKHKAETLLGYLREPRQEASTS 450 >ref|XP_002528228.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223532345|gb|EEF34143.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 467 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = +2 Query: 14 RNLLVREGGIHPLVALSQNGSAKAKHKAETLLGYLREPRQEASTS 148 R LLVREGGI PLVALSQ G+ +AKHKAETLLGYLREPRQEAS+S Sbjct: 421 RGLLVREGGIPPLVALSQTGTVRAKHKAETLLGYLREPRQEASSS 465 >ref|XP_003594249.1| U-box domain-containing protein [Medicago truncatula] gi|355483297|gb|AES64500.1| U-box domain-containing protein [Medicago truncatula] Length = 460 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = +2 Query: 14 RNLLVREGGIHPLVALSQNGSAKAKHKAETLLGYLREPRQEASTS 148 R LLVREGGI PLVALSQNG+ +AKHKAETLL YLRE RQEASTS Sbjct: 414 RGLLVREGGIPPLVALSQNGTPRAKHKAETLLRYLRESRQEASTS 458 >ref|XP_004134799.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus] gi|449524460|ref|XP_004169241.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus] Length = 459 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = +2 Query: 14 RNLLVREGGIHPLVALSQNGSAKAKHKAETLLGYLREPRQEASTS 148 R LLV EGGI PLVALSQ GS +AKHKAETLLGYLREPRQ AS+S Sbjct: 413 RGLLVSEGGIPPLVALSQTGSVRAKHKAETLLGYLREPRQVASSS 457