BLASTX nr result
ID: Lithospermum22_contig00008178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00008178 (695 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525962.1| hypothetical protein RCOM_0596970 [Ricinus c... 60 5e-07 ref|XP_002890861.1| hypothetical protein ARALYDRAFT_890567 [Arab... 59 7e-07 ref|XP_002519637.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 ref|NP_564352.1| uncharacterized protein [Arabidopsis thaliana] ... 58 2e-06 ref|XP_003524154.1| PREDICTED: CBL-interacting serine/threonine-... 56 6e-06 >ref|XP_002525962.1| hypothetical protein RCOM_0596970 [Ricinus communis] gi|223534694|gb|EEF36386.1| hypothetical protein RCOM_0596970 [Ricinus communis] Length = 79 Score = 59.7 bits (143), Expect = 5e-07 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +3 Query: 138 MASGRIARFVSEVAPPQFGKVMRQRASKRLDTIKEDEREAFYSN 269 MAS RIA+F++EVAPPQ+ VMR RASK LDTI E+ER+ SN Sbjct: 1 MASSRIAKFITEVAPPQYISVMRHRASKMLDTINEEERDVSPSN 44 >ref|XP_002890861.1| hypothetical protein ARALYDRAFT_890567 [Arabidopsis lyrata subsp. lyrata] gi|297336703|gb|EFH67120.1| hypothetical protein ARALYDRAFT_890567 [Arabidopsis lyrata subsp. lyrata] Length = 94 Score = 59.3 bits (142), Expect = 7e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +3 Query: 138 MASGRIARFVSEVAPPQFGKVMRQRASKRLDTIKEDERE 254 MAS R+ARF++EVAPPQF VMR+R +K LDTIKE+ERE Sbjct: 1 MASARLARFITEVAPPQFVTVMRRRTAKVLDTIKEEERE 39 >ref|XP_002519637.1| conserved hypothetical protein [Ricinus communis] gi|223541054|gb|EEF42610.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +3 Query: 138 MASGRIARFVSEVAPPQFGKVMRQRASKRLDTIKEDEREAFYSN 269 MA+ RIARF++EVAPPQ+ V+R+RASK LDTI E+ER+ SN Sbjct: 1 MANSRIARFITEVAPPQYISVIRRRASKMLDTINEEERDVSPSN 44 >ref|NP_564352.1| uncharacterized protein [Arabidopsis thaliana] gi|12320849|gb|AAG50559.1|AC073506_1 hypothetical protein [Arabidopsis thaliana] gi|16323184|gb|AAL15326.1| At1g30260/F12P21_9 [Arabidopsis thaliana] gi|21436007|gb|AAM51581.1| At1g30260/F12P21_9 [Arabidopsis thaliana] gi|332193079|gb|AEE31200.1| uncharacterized protein [Arabidopsis thaliana] Length = 97 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +3 Query: 138 MASGRIARFVSEVAPPQFGKVMRQRASKRLDTIKEDERE 254 MA+ R+ARF++EVAPPQF VMR+R +K LDTIKE+ERE Sbjct: 1 MATSRLARFITEVAPPQFVTVMRRRTAKVLDTIKEEERE 39 >ref|XP_003524154.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 23-like [Glycine max] Length = 621 Score = 56.2 bits (134), Expect = 6e-06 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +3 Query: 138 MASGRIARFVSEVAPPQFGKVMRQRASKRLDTIKEDERE 254 MA+ RIARF EVAPPQ+ VMR R SK LDTI EDERE Sbjct: 1 MANSRIARFFMEVAPPQYVTVMRHRTSKMLDTITEDERE 39