BLASTX nr result
ID: Lithospermum22_contig00008108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00008108 (486 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277741.2| PREDICTED: pentatricopeptide repeat-containi... 62 5e-08 >ref|XP_002277741.2| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Vitis vinifera] gi|297744624|emb|CBI37886.3| unnamed protein product [Vitis vinifera] Length = 648 Score = 62.0 bits (149), Expect = 5e-08 Identities = 33/58 (56%), Positives = 40/58 (68%) Frame = -3 Query: 481 RLCKEGVIESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVTESSYDSG 308 R+C+ E GQVVLL+N+YASVGRFQDAEALR +M K L K+ G S + YD G Sbjct: 591 RVCELDPEEPGQVVLLSNVYASVGRFQDAEALRASMKKKELIKNPGISLLNRIPYDVG 648