BLASTX nr result
ID: Lithospermum22_contig00007357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00007357 (518 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532440.1| Ubiquinol-cytochrome c reductase complex 7.8... 65 7e-09 emb|CBI18191.3| unnamed protein product [Vitis vinifera] 62 5e-08 ref|XP_002300924.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_003593124.1| Cytochrome b-c1 complex subunit [Medicago tr... 61 8e-08 ref|XP_004140689.1| PREDICTED: cytochrome b-c1 complex subunit 6... 60 2e-07 >ref|XP_002532440.1| Ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative [Ricinus communis] gi|223527860|gb|EEF29955.1| Ubiquinol-cytochrome c reductase complex 7.8 kDa protein, putative [Ricinus communis] Length = 110 Score = 64.7 bits (156), Expect = 7e-09 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -2 Query: 343 RSDEEPVDQKKLMEDRCKPKCVKQLRAYEACVDRIKGD 230 R+DEEPVDQKK +E+ CKPKCVK L YEACV RI+GD Sbjct: 35 RADEEPVDQKKYLEESCKPKCVKPLLEYEACVKRIRGD 72 >emb|CBI18191.3| unnamed protein product [Vitis vinifera] Length = 110 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -2 Query: 343 RSDEEPVDQKKLMEDRCKPKCVKQLRAYEACVDRIKGD 230 R+DEEPVD KK +E+ CKPKCV+ LRAYEAC +R+K D Sbjct: 42 RADEEPVDPKKYLEESCKPKCVRYLRAYEACENRVKED 79 >ref|XP_002300924.1| predicted protein [Populus trichocarpa] gi|222842650|gb|EEE80197.1| predicted protein [Populus trichocarpa] Length = 84 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 343 RSDEEPVDQKKLMEDRCKPKCVKQLRAYEACVDRIKGD 230 R+DEE VDQKK +ED CKPKCVK L YEACV R++GD Sbjct: 16 RADEELVDQKKYLEDSCKPKCVKPLLEYEACVKRVEGD 53 >ref|XP_003593124.1| Cytochrome b-c1 complex subunit [Medicago truncatula] gi|355482172|gb|AES63375.1| Cytochrome b-c1 complex subunit [Medicago truncatula] Length = 154 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -2 Query: 343 RSDEEPVDQKKLMEDRCKPKCVKQLRAYEACVDRIKGD 230 R+DEEPVD KKL+E+ CKPKCV+ L Y+AC+ RI+GD Sbjct: 86 RADEEPVDPKKLLEESCKPKCVRPLLEYQACIKRIQGD 123 >ref|XP_004140689.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Cucumis sativus] gi|449528698|ref|XP_004171340.1| PREDICTED: cytochrome b-c1 complex subunit 6-like [Cucumis sativus] Length = 69 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -2 Query: 340 SDEEPVDQKKLMEDRCKPKCVKQLRAYEACVDRIKGD 230 +DEEPVDQK+ +E+ CKPKCVK L Y+ACV RI+GD Sbjct: 2 ADEEPVDQKRYLEEACKPKCVKPLLEYQACVKRIQGD 38