BLASTX nr result
ID: Lithospermum22_contig00006949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00006949 (524 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001119182.1| RHOMBOID-like protein 3 [Arabidopsis thalian... 82 4e-14 ref|NP_196342.1| RHOMBOID-like protein 3 [Arabidopsis thaliana] ... 82 4e-14 ref|XP_002873304.1| rhomboid family protein [Arabidopsis lyrata ... 81 8e-14 ref|XP_002510823.1| KOM, putative [Ricinus communis] gi|22354993... 81 8e-14 ref|XP_004159491.1| PREDICTED: inactive rhomboid protein 1-like ... 80 1e-13 >ref|NP_001119182.1| RHOMBOID-like protein 3 [Arabidopsis thaliana] gi|332003745|gb|AED91128.1| RHOMBOID-like protein 3 [Arabidopsis thaliana] Length = 299 Score = 82.4 bits (202), Expect = 4e-14 Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = +1 Query: 364 SQWTSWLVPLIVVANVAMFIVVMFVNDCPNHNHLQRLSNQCVPRFLGRFSFQP 522 S+WTSWLVP+ VVANVA+F+V MFVN+CPNH RL CV +FLGR SF+P Sbjct: 51 SRWTSWLVPMFVVANVAVFVVAMFVNNCPNHFESHRLRGHCVAKFLGRLSFEP 103 >ref|NP_196342.1| RHOMBOID-like protein 3 [Arabidopsis thaliana] gi|7546703|emb|CAB87281.1| membrane protein [Arabidopsis thaliana] gi|16648762|gb|AAL25572.1| AT5g07250/T28J14_190 [Arabidopsis thaliana] gi|20466143|gb|AAM19993.1| AT5g07250/T28J14_190 [Arabidopsis thaliana] gi|332003744|gb|AED91127.1| RHOMBOID-like protein 3 [Arabidopsis thaliana] Length = 346 Score = 82.4 bits (202), Expect = 4e-14 Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = +1 Query: 364 SQWTSWLVPLIVVANVAMFIVVMFVNDCPNHNHLQRLSNQCVPRFLGRFSFQP 522 S+WTSWLVP+ VVANVA+F+V MFVN+CPNH RL CV +FLGR SF+P Sbjct: 51 SRWTSWLVPMFVVANVAVFVVAMFVNNCPNHFESHRLRGHCVAKFLGRLSFEP 103 >ref|XP_002873304.1| rhomboid family protein [Arabidopsis lyrata subsp. lyrata] gi|297319141|gb|EFH49563.1| rhomboid family protein [Arabidopsis lyrata subsp. lyrata] Length = 346 Score = 81.3 bits (199), Expect = 8e-14 Identities = 35/53 (66%), Positives = 41/53 (77%) Frame = +1 Query: 364 SQWTSWLVPLIVVANVAMFIVVMFVNDCPNHNHLQRLSNQCVPRFLGRFSFQP 522 S+WTSWLVP+ VVANVA+F+V MFVN+CP H RL CV RFLGR SF+P Sbjct: 51 SRWTSWLVPMFVVANVAIFVVAMFVNNCPKHFESHRLRGNCVARFLGRLSFEP 103 >ref|XP_002510823.1| KOM, putative [Ricinus communis] gi|223549938|gb|EEF51425.1| KOM, putative [Ricinus communis] Length = 325 Score = 81.3 bits (199), Expect = 8e-14 Identities = 34/54 (62%), Positives = 46/54 (85%) Frame = +1 Query: 361 DSQWTSWLVPLIVVANVAMFIVVMFVNDCPNHNHLQRLSNQCVPRFLGRFSFQP 522 ++QWTSWLVP+ VVANV++FI+VM++N+CP+H H R +CV RFLGRFSF+P Sbjct: 28 ETQWTSWLVPMFVVANVSVFIIVMYMNNCPDHFH-PRFEGKCVARFLGRFSFEP 80 >ref|XP_004159491.1| PREDICTED: inactive rhomboid protein 1-like [Cucumis sativus] Length = 322 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/54 (68%), Positives = 44/54 (81%) Frame = +1 Query: 361 DSQWTSWLVPLIVVANVAMFIVVMFVNDCPNHNHLQRLSNQCVPRFLGRFSFQP 522 + QWTSWLVP+ VVANVAMFIVVM+VN+CP H+ S +CV RFLGRFSF+P Sbjct: 30 EKQWTSWLVPMFVVANVAMFIVVMYVNNCPKHS---LGSEECVARFLGRFSFEP 80