BLASTX nr result
ID: Lithospermum22_contig00006693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00006693 (492 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC12819.1| cysteine synthase [Nicotiana tabacum] 89 3e-24 ref|XP_002336146.1| predicted protein [Populus trichocarpa] gi|2... 83 3e-22 ref|XP_002328363.1| predicted protein [Populus trichocarpa] gi|2... 82 5e-22 sp|O81154.1|CYSK_SOLTU RecName: Full=Cysteine synthase; AltName:... 84 8e-22 dbj|BAB20861.1| cytosolic cysteine synthase [Solanum tuberosum] 84 8e-22 >emb|CAC12819.1| cysteine synthase [Nicotiana tabacum] Length = 324 Score = 88.6 bits (218), Expect(2) = 3e-24 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = -2 Query: 491 GPHKIQGIGAGFIPPVLDTSILDGVIEVPSEEAIEMTRLLMLKEGLLVGISSGA 330 GPHKIQGIGAGF+P VLD SILD V++V S+EAIEMT+LL LKEGLLVGISSGA Sbjct: 221 GPHKIQGIGAGFVPVVLDLSILDEVLQVSSDEAIEMTKLLALKEGLLVGISSGA 274 Score = 48.1 bits (113), Expect(2) = 3e-24 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -3 Query: 208 VIFPSAGERYLSTVLFDSLREEASNMVVQ 122 VIFPS GERYLSTVLFDS+REE +NM + Sbjct: 295 VIFPSFGERYLSTVLFDSIREEVANMTFE 323 >ref|XP_002336146.1| predicted protein [Populus trichocarpa] gi|222874214|gb|EEF11345.1| predicted protein [Populus trichocarpa] Length = 325 Score = 82.8 bits (203), Expect(2) = 3e-22 Identities = 40/54 (74%), Positives = 45/54 (83%) Frame = -2 Query: 491 GPHKIQGIGAGFIPPVLDTSILDGVIEVPSEEAIEMTRLLMLKEGLLVGISSGA 330 GPHKIQGIGAGFIP VLD +LD +++ SEEAIE +LL LKEGLLVGISSGA Sbjct: 222 GPHKIQGIGAGFIPAVLDVGLLDETVQISSEEAIETAKLLALKEGLLVGISSGA 275 Score = 47.0 bits (110), Expect(2) = 3e-22 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -3 Query: 208 VIFPSAGERYLSTVLFDSLREEASNMV 128 VIFPS GERYLSTVLF+S+R+EA NMV Sbjct: 296 VIFPSFGERYLSTVLFESVRKEAENMV 322 >ref|XP_002328363.1| predicted protein [Populus trichocarpa] gi|222838078|gb|EEE76443.1| predicted protein [Populus trichocarpa] Length = 325 Score = 82.4 bits (202), Expect(2) = 5e-22 Identities = 40/54 (74%), Positives = 45/54 (83%) Frame = -2 Query: 491 GPHKIQGIGAGFIPPVLDTSILDGVIEVPSEEAIEMTRLLMLKEGLLVGISSGA 330 GPHKIQGIGAGFIP VLD +LD +++ SEEAIE +LL LKEGLLVGISSGA Sbjct: 222 GPHKIQGIGAGFIPGVLDVGLLDETVQISSEEAIETAKLLALKEGLLVGISSGA 275 Score = 47.0 bits (110), Expect(2) = 5e-22 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -3 Query: 208 VIFPSAGERYLSTVLFDSLREEASNMV 128 VIFPS GERYLSTVLF+S+R+EA NMV Sbjct: 296 VIFPSFGERYLSTVLFESVRKEAENMV 322 >sp|O81154.1|CYSK_SOLTU RecName: Full=Cysteine synthase; AltName: Full=CSase A; Short=CS-A; AltName: Full=O-acetylserine (thiol)-lyase; Short=OAS-TL A; AltName: Full=O-acetylserine sulfhydrylase gi|3290020|gb|AAC25635.1| cysteine synthase [Solanum tuberosum] Length = 325 Score = 84.0 bits (206), Expect(2) = 8e-22 Identities = 40/54 (74%), Positives = 48/54 (88%) Frame = -2 Query: 491 GPHKIQGIGAGFIPPVLDTSILDGVIEVPSEEAIEMTRLLMLKEGLLVGISSGA 330 GPHKIQGIGAGFIP VL+ +++D V++V SEE+IEM +LL LKEGLLVGISSGA Sbjct: 222 GPHKIQGIGAGFIPGVLEVNLIDDVVQVSSEESIEMAKLLALKEGLLVGISSGA 275 Score = 44.7 bits (104), Expect(2) = 8e-22 Identities = 20/29 (68%), Positives = 25/29 (86%) Frame = -3 Query: 208 VIFPSAGERYLSTVLFDSLREEASNMVVQ 122 VIFPS GERYLS+VLF+++R EA NM V+ Sbjct: 296 VIFPSFGERYLSSVLFETVRREAENMTVE 324 >dbj|BAB20861.1| cytosolic cysteine synthase [Solanum tuberosum] Length = 325 Score = 84.0 bits (206), Expect(2) = 8e-22 Identities = 40/54 (74%), Positives = 48/54 (88%) Frame = -2 Query: 491 GPHKIQGIGAGFIPPVLDTSILDGVIEVPSEEAIEMTRLLMLKEGLLVGISSGA 330 GPHKIQGIGAGFIP VL+ +++D V++V SEE+IEM +LL LKEGLLVGISSGA Sbjct: 222 GPHKIQGIGAGFIPGVLEVNLIDDVVQVSSEESIEMAKLLALKEGLLVGISSGA 275 Score = 44.7 bits (104), Expect(2) = 8e-22 Identities = 20/29 (68%), Positives = 25/29 (86%) Frame = -3 Query: 208 VIFPSAGERYLSTVLFDSLREEASNMVVQ 122 VIFPS GERYLS+VLF+++R EA NM V+ Sbjct: 296 VIFPSFGERYLSSVLFETVRREAENMTVE 324