BLASTX nr result
ID: Lithospermum22_contig00006688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00006688 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB55329.1| hypothetical protein 12.t00047 [Asparagus officin... 62 4e-08 >gb|ABB55329.1| hypothetical protein 12.t00047 [Asparagus officinalis] Length = 304 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/40 (75%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +1 Query: 115 VGYYNLPHLNTQRPR*ATT-HLGPYHPCEILEVAHTASRG 231 +GYY LPHLN+QRPR A + H PYHPCEILEVA TASRG Sbjct: 253 LGYYKLPHLNSQRPRYAKSYHPRPYHPCEILEVAPTASRG 292