BLASTX nr result
ID: Lithospermum22_contig00006578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00006578 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74132.1| hypothetical protein VITISV_015703 [Vitis vinifera] 57 1e-06 emb|CAN80975.1| hypothetical protein VITISV_039739 [Vitis vinifera] 55 8e-06 >emb|CAN74132.1| hypothetical protein VITISV_015703 [Vitis vinifera] Length = 254 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/56 (48%), Positives = 37/56 (66%) Frame = +2 Query: 35 AYNNQDNSSIKITSCILNGGNYWEWAKYVHLVICGRGEWGYITGSIRKPSEDESKF 202 A NN DN S+ IT +NG N+ W+++V L I G+G+ GY+TGS P ED+ KF Sbjct: 12 AANNFDNPSLSITIHKINGQNFLXWSQFVKLYIRGKGKIGYLTGSTXTPLEDDPKF 67 >emb|CAN80975.1| hypothetical protein VITISV_039739 [Vitis vinifera] Length = 274 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/50 (46%), Positives = 36/50 (72%) Frame = +2 Query: 35 AYNNQDNSSIKITSCILNGGNYWEWAKYVHLVICGRGEWGYITGSIRKPS 184 A+ DNSS++IT+ LNG NY +W++ + +VIC RG++ YITG + P+ Sbjct: 42 AFPGGDNSSLQITAHKLNGKNYLQWSQSIKIVICSRGKFKYITGEAKAPA 91