BLASTX nr result
ID: Lithospermum22_contig00005838
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00005838 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003613226.1| hypothetical protein MTR_5g034230 [Medicago ... 55 4e-06 >ref|XP_003613226.1| hypothetical protein MTR_5g034230 [Medicago truncatula] gi|355514561|gb|AES96184.1| hypothetical protein MTR_5g034230 [Medicago truncatula] Length = 248 Score = 55.5 bits (132), Expect = 4e-06 Identities = 31/45 (68%), Positives = 36/45 (80%), Gaps = 3/45 (6%) Frame = +2 Query: 125 SAHEV-YLKIKA-KENDKRKSYLPYRPEVFGFFTNVSG-GMSKNV 250 SAHE Y+ KA KENDKRKSYLPYR E+FGFF + +G GMS+NV Sbjct: 201 SAHEKHYVMSKARKENDKRKSYLPYRQELFGFFASTNGLGMSRNV 245