BLASTX nr result
ID: Lithospermum22_contig00005029
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00005029 (878 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004155826.1| PREDICTED: RNA polymerase I-specific transcr... 74 6e-11 ref|XP_004133864.1| PREDICTED: RNA polymerase I-specific transcr... 74 6e-11 ref|XP_002263973.2| PREDICTED: RNA polymerase I-specific transcr... 67 4e-09 emb|CBI37506.3| unnamed protein product [Vitis vinifera] 67 4e-09 ref|XP_002893635.1| predicted protein [Arabidopsis lyrata subsp.... 65 2e-08 >ref|XP_004155826.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Cucumis sativus] Length = 625 Score = 73.6 bits (179), Expect = 6e-11 Identities = 37/54 (68%), Positives = 42/54 (77%) Frame = +2 Query: 521 GNKFAMVLDNLLVLTFEHLKICYKSGRLMQVFKILLQSFQARVLTAYKSKFAQF 682 GN A LD+L+VLTFEHL+ C + GRL +VF ILL SFQ VLTAYKSKFAQF Sbjct: 280 GNVIAETLDSLIVLTFEHLESCERDGRLNEVFDILLLSFQRTVLTAYKSKFAQF 333 >ref|XP_004133864.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Cucumis sativus] Length = 626 Score = 73.6 bits (179), Expect = 6e-11 Identities = 37/54 (68%), Positives = 42/54 (77%) Frame = +2 Query: 521 GNKFAMVLDNLLVLTFEHLKICYKSGRLMQVFKILLQSFQARVLTAYKSKFAQF 682 GN A LD+L+VLTFEHL+ C + GRL +VF ILL SFQ VLTAYKSKFAQF Sbjct: 280 GNVIAETLDSLIVLTFEHLESCERDGRLNEVFDILLLSFQRTVLTAYKSKFAQF 333 >ref|XP_002263973.2| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Vitis vinifera] Length = 636 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/54 (61%), Positives = 41/54 (75%) Frame = +2 Query: 521 GNKFAMVLDNLLVLTFEHLKICYKSGRLMQVFKILLQSFQARVLTAYKSKFAQF 682 GN A LD+L+VLTFEHL+ C GRL++VF+ L+ SFQ VL A+KSKFAQF Sbjct: 290 GNLIAEKLDSLMVLTFEHLESCEAGGRLIEVFETLVLSFQTTVLNAFKSKFAQF 343 >emb|CBI37506.3| unnamed protein product [Vitis vinifera] Length = 607 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/54 (61%), Positives = 41/54 (75%) Frame = +2 Query: 521 GNKFAMVLDNLLVLTFEHLKICYKSGRLMQVFKILLQSFQARVLTAYKSKFAQF 682 GN A LD+L+VLTFEHL+ C GRL++VF+ L+ SFQ VL A+KSKFAQF Sbjct: 281 GNLIAEKLDSLMVLTFEHLESCEAGGRLIEVFETLVLSFQTTVLNAFKSKFAQF 334 >ref|XP_002893635.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297339477|gb|EFH69894.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 610 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/59 (52%), Positives = 42/59 (71%) Frame = +2 Query: 506 QNMFRGNKFAMVLDNLLVLTFEHLKICYKSGRLMQVFKILLQSFQARVLTAYKSKFAQF 682 QN GN + +LD L+VL F+HL+ C SGRL +VF+IL QSF+ +L Y+SKF+QF Sbjct: 273 QNTSGGNVVSELLDKLMVLFFDHLESCQNSGRLDEVFEILFQSFENYILNTYRSKFSQF 331