BLASTX nr result
ID: Lithospermum22_contig00004331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00004331 (664 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109553.1| hypothetical protein Poptr_cp075 [Populus tr... 86 6e-15 >ref|YP_001109553.1| hypothetical protein Poptr_cp075 [Populus trichocarpa] gi|134093265|ref|YP_001109566.1| hypothetical protein Poptr_cp088 [Populus trichocarpa] gi|133712114|gb|ABO36757.1| hypothetical protein Poptr_cp075 [Populus trichocarpa] gi|133712127|gb|ABO36770.1| hypothetical protein Poptr_cp088 [Populus trichocarpa] Length = 86 Score = 85.9 bits (211), Expect = 6e-15 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 141 MDWCGSSTPRTPEYRTMNEERHERKAYWLVIVRPQFWTIG 22 MDWCGSSTPRTPEYRTMNEERHERKAYWLVIVRPQF T G Sbjct: 1 MDWCGSSTPRTPEYRTMNEERHERKAYWLVIVRPQFLTGG 40