BLASTX nr result
ID: Lithospermum22_contig00004189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00004189 (1048 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC65222.1| hypothetical protein [Daucus carota] 60 7e-07 ref|XP_002520830.1| conserved hypothetical protein [Ricinus comm... 57 8e-06 >dbj|BAC65222.1| hypothetical protein [Daucus carota] Length = 374 Score = 60.5 bits (145), Expect = 7e-07 Identities = 47/149 (31%), Positives = 73/149 (48%), Gaps = 4/149 (2%) Frame = -2 Query: 765 LKRAKERAKATVVPPG-DIISQTKNKEKGIVTRQSLNPVEF-EDIGKSIAMYSNCLHPLK 592 L+ AK++ K + P +++TK+K K IVT ++ ++ G+ ++ +C PL Sbjct: 239 LESAKDKGKKSDATPCLPSLAKTKDKGKTIVTAAGFPTLKKRKEKGQGVSFSYSCPPPLP 298 Query: 591 FEENMKKEVAVLSFSLLGTSTMRKRSNDIKKTGPINSWMNPHPKKVKKRSI--RQETDRE 418 +++ E+ N + P +PH KKR R + E Sbjct: 299 KGRHIRNEL-----------------NGSGDSEPSEFRTDPHMMHKKKRRCMPRDQDTLE 341 Query: 417 YSLPRDYCEKQRAYYKEVDDFELLEEEIS 331 LP D+ EKQRAY+KEVD+FELLEEE S Sbjct: 342 CILPADFIEKQRAYFKEVDEFELLEEEAS 370 >ref|XP_002520830.1| conserved hypothetical protein [Ricinus communis] gi|223539961|gb|EEF41539.1| conserved hypothetical protein [Ricinus communis] Length = 219 Score = 57.0 bits (136), Expect = 8e-06 Identities = 31/77 (40%), Positives = 47/77 (61%) Frame = -2 Query: 552 FSLLGTSTMRKRSNDIKKTGPINSWMNPHPKKVKKRSIRQETDREYSLPRDYCEKQRAYY 373 F L T N+ + T S + P+ KK ++R I +E D +Y+LP+D+ E+QRAY+ Sbjct: 141 FPALKTQFTGSEMNEREVTSLSKSCVLPYEKKQRQR-IPKEDDAKYALPQDFIERQRAYF 199 Query: 372 KEVDDFELLEEEISYQD 322 E+D FEL EEE++ D Sbjct: 200 AEIDAFELPEEEVASID 216