BLASTX nr result
ID: Lithospermum22_contig00003400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00003400 (1936 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630108.1| hypothetical protein MTR_8g091870 [Medicago ... 40 3e-07 ref|XP_003604996.1| hypothetical protein MTR_4g022640 [Medicago ... 42 5e-06 >ref|XP_003630108.1| hypothetical protein MTR_8g091870 [Medicago truncatula] gi|355524130|gb|AET04584.1| hypothetical protein MTR_8g091870 [Medicago truncatula] Length = 423 Score = 40.4 bits (93), Expect(3) = 3e-07 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +1 Query: 31 IWIRLEGLPLYLFDEASLLAIANAIGTPLRVD 126 +W+R GL L +DE LLA+A+AIG P++VD Sbjct: 124 VWVRFPGLNLVYYDENFLLAMASAIGRPIKVD 155 Score = 31.6 bits (70), Expect(3) = 3e-07 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 403 LEGFWVKVYYDVIPPFCTFCSHIGHHLRACKRRS 504 + G W K+ Y+ + CT C GH R C ++S Sbjct: 185 VNGHWYKIQYEWLHLICTNCGCCGHLRRNCSQKS 218 Score = 30.0 bits (66), Expect(3) = 3e-07 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +2 Query: 215 MNIKRVKLNSARVCVELNVAGPLFDSIWV 301 +N++R K ARVCVE+++ P+ IWV Sbjct: 159 LNVERGKF--ARVCVEIDLTAPVVGKIWV 185 >ref|XP_003604996.1| hypothetical protein MTR_4g022640 [Medicago truncatula] gi|355506051|gb|AES87193.1| hypothetical protein MTR_4g022640 [Medicago truncatula] Length = 513 Score = 41.6 bits (96), Expect(3) = 5e-06 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = +1 Query: 31 IWIRLEGLPLYLFDEASLLAIANAIGTPLRVD 126 +W+R GL L +DE+ LLA+A+AIG P++VD Sbjct: 173 VWVRFPGLNLVYYDESFLLAMASAIGRPIKVD 204 Score = 29.3 bits (64), Expect(3) = 5e-06 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 403 LEGFWVKVYYDVIPPFCTFCSHIGHHLRACKRRSGK 510 + G W K+ Y+ + CT C GH R C + + K Sbjct: 234 VNGHWYKIQYEGLHLICTNCGCYGHLGRNCNQPTTK 269 Score = 26.6 bits (57), Expect(3) = 5e-06 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 245 ARVCVELNVAGPLFDSIWV 301 ARVCVE+++ P+ IWV Sbjct: 216 ARVCVEIDLTVPVVGKIWV 234