BLASTX nr result
ID: Lithospermum22_contig00003205
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00003205 (506 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABS19630.2| carotenoid cleavage dioxygenase [Bixa orellana] 57 1e-06 gb|ADN65332.1| carotenoid cleavage dioxygenase 1 [Manihot escule... 55 5e-06 >gb|ABS19630.2| carotenoid cleavage dioxygenase [Bixa orellana] Length = 542 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/69 (43%), Positives = 44/69 (63%) Frame = +1 Query: 298 DGLVKVKPKCKKGPQSRSVDAMVKKVFDLYKPPEGNLKYLQENFAPIRVETPPTTNITVT 477 +G+++V PK +KG +S +D + K + L P L +L NFAPI ETPPTT++ V Sbjct: 16 NGILEVNPKPQKGLKSTLIDWLEKLIVKLMHDPSQPLPFLTGNFAPIPHETPPTTDLPV- 74 Query: 478 EGHIPSDLN 504 +GH+P LN Sbjct: 75 KGHLPECLN 83 >gb|ADN65332.1| carotenoid cleavage dioxygenase 1 [Manihot esculenta] Length = 552 Score = 55.5 bits (132), Expect = 5e-06 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 4/71 (5%) Frame = +1 Query: 304 LVKVKPKCKKGPQSRSVDAM----VKKVFDLYKPPEGNLKYLQENFAPIRVETPPTTNIT 471 +V+VKPK +KG S+ VD + VK +FD KP L YL NFAP+ ETPP +++ Sbjct: 22 IVEVKPKPRKGLASKFVDLLEKLIVKLMFDASKP----LHYLSGNFAPVTDETPPVRDLS 77 Query: 472 VTEGHIPSDLN 504 V +GH+P LN Sbjct: 78 V-KGHLPDCLN 87