BLASTX nr result
ID: Lithospermum22_contig00003034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00003034 (469 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321754.1| predicted protein [Populus trichocarpa] gi|1... 76 2e-12 ref|XP_002318177.1| predicted protein [Populus trichocarpa] gi|2... 74 1e-11 gb|ABK94190.1| unknown [Populus trichocarpa] 74 1e-11 ref|XP_002514207.1| conserved hypothetical protein [Ricinus comm... 73 2e-11 gb|ADR71293.1| hypothetical protein 17 [Hevea brasiliensis] 72 5e-11 >ref|XP_002321754.1| predicted protein [Populus trichocarpa] gi|118488859|gb|ABK96239.1| unknown [Populus trichocarpa x Populus deltoides] gi|222868750|gb|EEF05881.1| predicted protein [Populus trichocarpa] Length = 75 Score = 76.3 bits (186), Expect = 2e-12 Identities = 33/54 (61%), Positives = 44/54 (81%) Frame = +2 Query: 92 TSKASGKHQESKRDRKSGSGFNGSPKKGGHGGKFTWSGDGYSEAELGCFDKEAI 253 +S + ++++DRKSG+G +GSPKKGGHGGKFTW GDGYS AE+G F+KEA+ Sbjct: 7 SSSNNNPKSDARKDRKSGTGMSGSPKKGGHGGKFTWVGDGYSNAEIG-FEKEAV 59 >ref|XP_002318177.1| predicted protein [Populus trichocarpa] gi|222858850|gb|EEE96397.1| predicted protein [Populus trichocarpa] Length = 73 Score = 73.9 bits (180), Expect = 1e-11 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = +2 Query: 119 ESKRDRKSGSGFNGSPKKGGHGGKFTWSGDGYSEAELGCFDKEAI 253 E ++D KSG+G +GSPKKGGHGGKFTW GDGYS+AE+G F+KEA+ Sbjct: 14 EVRKDSKSGTGLSGSPKKGGHGGKFTWVGDGYSQAEIG-FEKEAV 57 >gb|ABK94190.1| unknown [Populus trichocarpa] Length = 75 Score = 73.9 bits (180), Expect = 1e-11 Identities = 32/54 (59%), Positives = 43/54 (79%) Frame = +2 Query: 92 TSKASGKHQESKRDRKSGSGFNGSPKKGGHGGKFTWSGDGYSEAELGCFDKEAI 253 +S + ++++DRKSG+G +GSPKKGGHGGKFTW DGYS AE+G F+KEA+ Sbjct: 7 SSSNNNPKSDARKDRKSGTGMSGSPKKGGHGGKFTWVSDGYSNAEIG-FEKEAV 59 >ref|XP_002514207.1| conserved hypothetical protein [Ricinus communis] gi|223546663|gb|EEF48161.1| conserved hypothetical protein [Ricinus communis] Length = 78 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/51 (64%), Positives = 42/51 (82%), Gaps = 2/51 (3%) Frame = +2 Query: 86 GNTSKASGKHQES--KRDRKSGSGFNGSPKKGGHGGKFTWSGDGYSEAELG 232 G +SK+S + +S +RDRKS +G +GSPKKGGHGGKFTW+GDGYS AE+G Sbjct: 5 GKSSKSSTANSKSDARRDRKSATGMSGSPKKGGHGGKFTWAGDGYSPAEIG 55 >gb|ADR71293.1| hypothetical protein 17 [Hevea brasiliensis] Length = 76 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/52 (63%), Positives = 41/52 (78%), Gaps = 4/52 (7%) Frame = +2 Query: 89 NTSKASGKHQESK----RDRKSGSGFNGSPKKGGHGGKFTWSGDGYSEAELG 232 NT K+S + SK +DRKS +G +GSPKKGGHGGKFTW+GDGYS+AE+G Sbjct: 3 NTVKSSKTNANSKSDVRKDRKSATGMSGSPKKGGHGGKFTWAGDGYSQAEIG 54