BLASTX nr result
ID: Lithospermum22_contig00002952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00002952 (1483 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB54351.2| cytochrome oxidase subunit I [Allium cepa] 69 4e-09 gb|ABY83864.1| cytochrome oxidase subunit 1 [Ochrosia elliptica] 68 7e-09 gb|AAP58356.1| cytoplasmic male sterility-associated cytochrome ... 68 7e-09 gb|AFR34306.1| cytochrome c oxidase subunit 1 (mitochondrion) [G... 67 9e-09 ref|XP_004173300.1| PREDICTED: cytochrome c oxidase subunit 1-li... 67 9e-09 >gb|ADB54351.2| cytochrome oxidase subunit I [Allium cepa] Length = 533 Score = 68.6 bits (166), Expect = 4e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 379 FVAIAGVMGTCFSVLIRMELARPGDQILGGNHQ 281 F AIAGVMGTCFSVLIRMELARPGDQILGGNHQ Sbjct: 28 FAAIAGVMGTCFSVLIRMELARPGDQILGGNHQ 60 >gb|ABY83864.1| cytochrome oxidase subunit 1 [Ochrosia elliptica] Length = 519 Score = 67.8 bits (164), Expect = 7e-09 Identities = 35/52 (67%), Positives = 39/52 (75%), Gaps = 4/52 (7%) Frame = -1 Query: 424 SVPWKYFVKPQNLR----FFVAIAGVMGTCFSVLIRMELARPGDQILGGNHQ 281 SV W + +++ F AIAGVMGTCFSVLIRMELARPGDQILGGNHQ Sbjct: 4 SVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQ 55 >gb|AAP58356.1| cytoplasmic male sterility-associated cytochrome oxidase subunit I [Brassica juncea] Length = 527 Score = 67.8 bits (164), Expect = 7e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 379 FVAIAGVMGTCFSVLIRMELARPGDQILGGNHQ 281 F AIAGVMGTCFSVLIRMELARPGDQILGGNHQ Sbjct: 23 FSAIAGVMGTCFSVLIRMELARPGDQILGGNHQ 55 >gb|AFR34306.1| cytochrome c oxidase subunit 1 (mitochondrion) [Glycine max] Length = 527 Score = 67.4 bits (163), Expect = 9e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 379 FVAIAGVMGTCFSVLIRMELARPGDQILGGNHQ 281 F AIAGVMGTCFSVLIRMELARPGDQILGGNHQ Sbjct: 23 FGAIAGVMGTCFSVLIRMELARPGDQILGGNHQ 55 >ref|XP_004173300.1| PREDICTED: cytochrome c oxidase subunit 1-like, partial [Cucumis sativus] Length = 257 Score = 67.4 bits (163), Expect = 9e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 379 FVAIAGVMGTCFSVLIRMELARPGDQILGGNHQ 281 F AIAGVMGTCFSVLIRMELARPGDQILGGNHQ Sbjct: 39 FGAIAGVMGTCFSVLIRMELARPGDQILGGNHQ 71