BLASTX nr result
ID: Lithospermum22_contig00002512
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00002512 (644 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB17076.1| invertase inhibitor [Nicotiana langsdorffii x Nic... 122 6e-26 pdb|1RJ1|A Chain A, Crystal Structure Of A Cell Wall Invertase I... 120 2e-25 emb|CAA73333.1| invertase inhibitor [Nicotiana tabacum] 120 2e-25 pdb|2XQR|B Chain B, Crystal Structure Of Plant Cell Wall Inverta... 120 2e-25 pdb|2CJ4|A Chain A, Crystal Structure Of A Cell Wall Invertase I... 120 2e-25 >gb|ABB17076.1| invertase inhibitor [Nicotiana langsdorffii x Nicotiana sanderae] Length = 165 Score = 122 bits (306), Expect = 6e-26 Identities = 68/148 (45%), Positives = 93/148 (62%) Frame = -2 Query: 502 DIIDSTCKNTPNPQLCSSILRKSPQSKIKDTRGLALILSGALKSRVELSLKRIDALKKKS 323 +++++TCKNTPN QLC L +S+ D LALI+ A+KS+ + I L+ + Sbjct: 20 NLVETTCKNTPNYQLCLKTLLSDKRSETGDITTLALIMVDAIKSKANQAAVTISKLRHSN 79 Query: 322 KSAESMRDQLQECGEIYKIVLQVEIPEIFEGLNKGNPKFAEDGVVGVTQGAQECEESFKK 143 A + + L+ C YK++L +PE E L KG+PKFAEDG+VG + AQECEE F K Sbjct: 80 PPA-AWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYF-K 137 Query: 142 GSKNPVSASNKSVTDLAGVTRAIVRMLL 59 GSK+P SA N +V L+ V RAIVR LL Sbjct: 138 GSKSPFSALNDAVHQLSDVGRAIVRNLL 165 >pdb|1RJ1|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor From Tobacco gi|42543559|pdb|1RJ4|A Chain A, Structure Of A Cell Wall Invertase Inhibitor From Tobacco In Complex With Cd2+ gi|42543560|pdb|1RJ4|B Chain B, Structure Of A Cell Wall Invertase Inhibitor From Tobacco In Complex With Cd2+ gi|42543561|pdb|1RJ4|C Chain C, Structure Of A Cell Wall Invertase Inhibitor From Tobacco In Complex With Cd2+ gi|42543562|pdb|1RJ4|D Chain D, Structure Of A Cell Wall Invertase Inhibitor From Tobacco In Complex With Cd2+ Length = 151 Score = 120 bits (301), Expect = 2e-25 Identities = 67/148 (45%), Positives = 93/148 (62%) Frame = -2 Query: 502 DIIDSTCKNTPNPQLCSSILRKSPQSKIKDTRGLALILSGALKSRVELSLKRIDALKKKS 323 +++++TCKNTPN QLC L +S D LALI+ A+K++ + I L+ + Sbjct: 6 NLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSN 65 Query: 322 KSAESMRDQLQECGEIYKIVLQVEIPEIFEGLNKGNPKFAEDGVVGVTQGAQECEESFKK 143 A + + L+ C YK++L +PE E L KG+PKFAEDG+VG + AQECEE F K Sbjct: 66 PPA-AWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYF-K 123 Query: 142 GSKNPVSASNKSVTDLAGVTRAIVRMLL 59 GSK+P SA N +V +L+ V RAIVR LL Sbjct: 124 GSKSPFSALNIAVHELSDVGRAIVRNLL 151 >emb|CAA73333.1| invertase inhibitor [Nicotiana tabacum] Length = 166 Score = 120 bits (301), Expect = 2e-25 Identities = 67/148 (45%), Positives = 93/148 (62%) Frame = -2 Query: 502 DIIDSTCKNTPNPQLCSSILRKSPQSKIKDTRGLALILSGALKSRVELSLKRIDALKKKS 323 +++++TCKNTPN QLC L +S D LALI+ A+K++ + I L+ + Sbjct: 21 NLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSN 80 Query: 322 KSAESMRDQLQECGEIYKIVLQVEIPEIFEGLNKGNPKFAEDGVVGVTQGAQECEESFKK 143 A + + L+ C YK++L +PE E L KG+PKFAEDG+VG + AQECEE F K Sbjct: 81 PPA-AWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYF-K 138 Query: 142 GSKNPVSASNKSVTDLAGVTRAIVRMLL 59 GSK+P SA N +V +L+ V RAIVR LL Sbjct: 139 GSKSPFSALNIAVHELSDVGRAIVRNLL 166 >pdb|2XQR|B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor gi|308198423|pdb|2XQR|D Chain D, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor gi|308198425|pdb|2XQR|F Chain F, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor gi|308198427|pdb|2XQR|H Chain H, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor gi|308198429|pdb|2XQR|J Chain J, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor gi|308198431|pdb|2XQR|L Chain L, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor Length = 149 Score = 120 bits (301), Expect = 2e-25 Identities = 67/148 (45%), Positives = 93/148 (62%) Frame = -2 Query: 502 DIIDSTCKNTPNPQLCSSILRKSPQSKIKDTRGLALILSGALKSRVELSLKRIDALKKKS 323 +++++TCKNTPN QLC L +S D LALI+ A+K++ + I L+ + Sbjct: 4 NLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSN 63 Query: 322 KSAESMRDQLQECGEIYKIVLQVEIPEIFEGLNKGNPKFAEDGVVGVTQGAQECEESFKK 143 A + + L+ C YK++L +PE E L KG+PKFAEDG+VG + AQECEE F K Sbjct: 64 PPA-AWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYF-K 121 Query: 142 GSKNPVSASNKSVTDLAGVTRAIVRMLL 59 GSK+P SA N +V +L+ V RAIVR LL Sbjct: 122 GSKSPFSALNIAVHELSDVGRAIVRNLL 149 >pdb|2CJ4|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor From Tobacco At Ph 4.6 gi|93279168|pdb|2CJ4|B Chain B, Crystal Structure Of A Cell Wall Invertase Inhibitor From Tobacco At Ph 4.6 gi|93279169|pdb|2CJ5|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor From Tobacco (Ph 5.0) gi|93279170|pdb|2CJ6|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor From Tobacco (Ph 7.5) gi|99031976|pdb|2CJ7|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor From Tobacco (ph 9.0) gi|99031977|pdb|2CJ8|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor From Tobacco (Ph 9.5) gi|99031978|pdb|2CJ8|B Chain B, Crystal Structure Of A Cell Wall Invertase Inhibitor From Tobacco (Ph 9.5) Length = 150 Score = 120 bits (301), Expect = 2e-25 Identities = 67/148 (45%), Positives = 93/148 (62%) Frame = -2 Query: 502 DIIDSTCKNTPNPQLCSSILRKSPQSKIKDTRGLALILSGALKSRVELSLKRIDALKKKS 323 +++++TCKNTPN QLC L +S D LALI+ A+K++ + I L+ + Sbjct: 5 NLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSN 64 Query: 322 KSAESMRDQLQECGEIYKIVLQVEIPEIFEGLNKGNPKFAEDGVVGVTQGAQECEESFKK 143 A + + L+ C YK++L +PE E L KG+PKFAEDG+VG + AQECEE F K Sbjct: 65 PPA-AWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYF-K 122 Query: 142 GSKNPVSASNKSVTDLAGVTRAIVRMLL 59 GSK+P SA N +V +L+ V RAIVR LL Sbjct: 123 GSKSPFSALNIAVHELSDVGRAIVRNLL 150