BLASTX nr result
ID: Lithospermum22_contig00001846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00001846 (726 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305407.1| predicted protein [Populus trichocarpa] gi|1... 97 3e-18 ref|XP_002313822.1| predicted protein [Populus trichocarpa] gi|1... 96 1e-17 ref|XP_002519115.1| conserved hypothetical protein [Ricinus comm... 95 1e-17 ref|XP_004145344.1| PREDICTED: mitochondrial import receptor sub... 94 3e-17 ref|NP_564545.1| mitochondrial import receptor subunit TOM6-like... 92 8e-17 >ref|XP_002305407.1| predicted protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| predicted protein [Populus trichocarpa] Length = 54 Score = 97.1 bits (240), Expect = 3e-18 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = -2 Query: 626 MFPGMFMKKPDKAAALKQLKSHLAAFGAWVVVLRATPYVLHYFSGTKDELKLDF 465 MFPGMFM+KPDKA ALKQLKSH+A FGAWVVVLR TPYVLHY S KDELKL+F Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPYVLHYLSDEKDELKLEF 54 >ref|XP_002313822.1| predicted protein [Populus trichocarpa] gi|118483621|gb|ABK93705.1| unknown [Populus trichocarpa] gi|222850230|gb|EEE87777.1| predicted protein [Populus trichocarpa] Length = 54 Score = 95.5 bits (236), Expect = 1e-17 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = -2 Query: 626 MFPGMFMKKPDKAAALKQLKSHLAAFGAWVVVLRATPYVLHYFSGTKDELKLDF 465 MFPG+FMKKPDKA ALKQL+SH+A FGAWVVVLR TPYVLHY S KDELKL+F Sbjct: 1 MFPGLFMKKPDKAEALKQLRSHVAMFGAWVVVLRVTPYVLHYISHEKDELKLEF 54 >ref|XP_002519115.1| conserved hypothetical protein [Ricinus communis] gi|223541778|gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 95.1 bits (235), Expect = 1e-17 Identities = 43/54 (79%), Positives = 47/54 (87%) Frame = -2 Query: 626 MFPGMFMKKPDKAAALKQLKSHLAAFGAWVVVLRATPYVLHYFSGTKDELKLDF 465 MFPGMFM+KPDKAAALKQLK+H A FGAWV ++R TPYVLHY S KDELKLDF Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHAAIFGAWVALIRVTPYVLHYLSDDKDELKLDF 54 >ref|XP_004145344.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449455208|ref|XP_004145345.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474805|ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474809|ref|XP_004154291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532212|ref|XP_004173076.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532214|ref|XP_004173077.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] Length = 54 Score = 94.0 bits (232), Expect = 3e-17 Identities = 42/54 (77%), Positives = 47/54 (87%) Frame = -2 Query: 626 MFPGMFMKKPDKAAALKQLKSHLAAFGAWVVVLRATPYVLHYFSGTKDELKLDF 465 MFPGMFM+KPDKAAALKQL+SH+A FG WV V+R TPYVLHY S K+ELKLDF Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLSDEKEELKLDF 54 >ref|NP_564545.1| mitochondrial import receptor subunit TOM6-like protein [Arabidopsis thaliana] gi|46577137|sp|Q9XIA7.1|TOM6_ARATH RecName: Full=Mitochondrial import receptor subunit TOM6 homolog; AltName: Full=Translocase of outer membrane 6 kDa subunit homolog gi|5430759|gb|AAD43159.1|AC007504_14 Unknown Protein [Arabidopsis thaliana] gi|11692924|gb|AAG40065.1|AF324714_1 At1g49410 [Arabidopsis thaliana] gi|11762280|gb|AAG40411.1|AF325059_1 At1g49410 [Arabidopsis thaliana] gi|11935199|gb|AAG42015.1|AF327425_1 unknown protein [Arabidopsis thaliana] gi|12642920|gb|AAK00402.1|AF339720_1 unknown protein [Arabidopsis thaliana] gi|14335020|gb|AAK59774.1| At1g49410/F13F21_16 [Arabidopsis thaliana] gi|27363338|gb|AAO11588.1| At1g49410/F13F21_16 [Arabidopsis thaliana] gi|332194306|gb|AEE32427.1| mitochondrial import receptor subunit TOM6-like protein [Arabidopsis thaliana] Length = 54 Score = 92.4 bits (228), Expect = 8e-17 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = -2 Query: 626 MFPGMFMKKPDKAAALKQLKSHLAAFGAWVVVLRATPYVLHYFSGTKDELKLDF 465 MFPGMFM+KPDKA ALKQL++H+A FG+WVV++RA PYVL YFS +KDELK+DF Sbjct: 1 MFPGMFMRKPDKAEALKQLRTHVALFGSWVVIIRAAPYVLSYFSDSKDELKIDF 54