BLASTX nr result
ID: Lithospermum22_contig00000898
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00000898 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511117.1| ubiquitin-conjugating enzyme E2-25kD, putati... 59 3e-07 gb|ABK21242.1| unknown [Picea sitchensis] gi|294463295|gb|ADE771... 55 6e-06 ref|XP_002459014.1| hypothetical protein SORBIDRAFT_03g044480 [S... 55 8e-06 >ref|XP_002511117.1| ubiquitin-conjugating enzyme E2-25kD, putative [Ricinus communis] gi|223550232|gb|EEF51719.1| ubiquitin-conjugating enzyme E2-25kD, putative [Ricinus communis] Length = 194 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 268 EMGFPEGVVRSTLEAVGGDENMALEKLCSG 179 EMGFPEG+VRSTLEAV GDEN+ALEKLCSG Sbjct: 165 EMGFPEGLVRSTLEAVSGDENLALEKLCSG 194 >gb|ABK21242.1| unknown [Picea sitchensis] gi|294463295|gb|ADE77183.1| unknown [Picea sitchensis] Length = 195 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 268 EMGFPEGVVRSTLEAVGGDENMALEKLCSG 179 EMGFPE +VR+TLE GGDENMALEKLCSG Sbjct: 166 EMGFPEDMVRTTLEQCGGDENMALEKLCSG 195 >ref|XP_002459014.1| hypothetical protein SORBIDRAFT_03g044480 [Sorghum bicolor] gi|241930989|gb|EES04134.1| hypothetical protein SORBIDRAFT_03g044480 [Sorghum bicolor] Length = 195 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 268 EMGFPEGVVRSTLEAVGGDENMALEKLCSG 179 EMGFPE +VRSTL++V GDENMALEKLCSG Sbjct: 166 EMGFPEDLVRSTLKSVDGDENMALEKLCSG 195