BLASTX nr result
ID: Lithospermum22_contig00000240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00000240 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004165280.1| PREDICTED: probable histone H2A.4-like [Cucu... 72 5e-11 ref|XP_004142082.1| PREDICTED: probable histone H2A.4-like [Cucu... 72 5e-11 ref|XP_002533104.1| histone h2a, putative [Ricinus communis] gi|... 71 8e-11 ref|XP_002533102.1| histone h2a, putative [Ricinus communis] gi|... 71 8e-11 gb|AFW78282.1| hypothetical protein ZEAMMB73_348782 [Zea mays] 70 2e-10 >ref|XP_004165280.1| PREDICTED: probable histone H2A.4-like [Cucumis sativus] Length = 152 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 90 PVTRSVRAGLQFPVGRIGRYLKNGRYSQRVGTGAP 194 PV+RSV+AGLQFPVGRIGRYLKNGRYSQRVGTGAP Sbjct: 24 PVSRSVKAGLQFPVGRIGRYLKNGRYSQRVGTGAP 58 >ref|XP_004142082.1| PREDICTED: probable histone H2A.4-like [Cucumis sativus] Length = 152 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 90 PVTRSVRAGLQFPVGRIGRYLKNGRYSQRVGTGAP 194 PV+RSV+AGLQFPVGRIGRYLKNGRYSQRVGTGAP Sbjct: 24 PVSRSVKAGLQFPVGRIGRYLKNGRYSQRVGTGAP 58 >ref|XP_002533104.1| histone h2a, putative [Ricinus communis] gi|223527095|gb|EEF29276.1| histone h2a, putative [Ricinus communis] Length = 150 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 90 PVTRSVRAGLQFPVGRIGRYLKNGRYSQRVGTGAP 194 PVTRSVRAGLQFPVGRIGRYLK GRY+QRVGTGAP Sbjct: 23 PVTRSVRAGLQFPVGRIGRYLKKGRYAQRVGTGAP 57 >ref|XP_002533102.1| histone h2a, putative [Ricinus communis] gi|223527093|gb|EEF29274.1| histone h2a, putative [Ricinus communis] Length = 150 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 90 PVTRSVRAGLQFPVGRIGRYLKNGRYSQRVGTGAP 194 PVTRSVRAGLQFPVGRIGRYLK GRY+QRVGTGAP Sbjct: 23 PVTRSVRAGLQFPVGRIGRYLKKGRYAQRVGTGAP 57 >gb|AFW78282.1| hypothetical protein ZEAMMB73_348782 [Zea mays] Length = 157 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 90 PVTRSVRAGLQFPVGRIGRYLKNGRYSQRVGTGAP 194 PV+RSV+AGLQFPVGRIGRYLK GRYSQRVGTGAP Sbjct: 25 PVSRSVKAGLQFPVGRIGRYLKQGRYSQRVGTGAP 59