BLASTX nr result
ID: Jatropha_contig00046847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00046847 (408 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511747.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 gb|ESR58457.1| hypothetical protein CICLE_v10022036mg [Citrus cl... 59 5e-07 ref|XP_004160663.1| PREDICTED: uncharacterized LOC101205981 isof... 55 9e-06 ref|XP_004144999.1| PREDICTED: uncharacterized protein LOC101205... 55 9e-06 >ref|XP_002511747.1| conserved hypothetical protein [Ricinus communis] gi|223548927|gb|EEF50416.1| conserved hypothetical protein [Ricinus communis] Length = 214 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +2 Query: 53 KHLGHSSQEKERVQAVGAYRKRRGWTSRPGLQLPAVTTTPSL 178 K++ +SQE+ R++A+ AYRKR+GWTSRPGLQLP VT TPSL Sbjct: 173 KNVPDASQERVRLKAIEAYRKRKGWTSRPGLQLPNVTATPSL 214 >gb|ESR58457.1| hypothetical protein CICLE_v10022036mg [Citrus clementina] Length = 232 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/53 (56%), Positives = 40/53 (75%) Frame = +2 Query: 20 PQQPVTEPFLVKHLGHSSQEKERVQAVGAYRKRRGWTSRPGLQLPAVTTTPSL 178 P + VT P +K +S+E+ R+QA+ AYR R+GWTSRPGLQLP V+T+PSL Sbjct: 182 PPKLVTVPKALKT--DASKERLRLQAIEAYRNRKGWTSRPGLQLPPVSTSPSL 232 >ref|XP_004160663.1| PREDICTED: uncharacterized LOC101205981 isoform 1 [Cucumis sativus] gi|449498896|ref|XP_004160664.1| PREDICTED: uncharacterized LOC101205981 isoform 2 [Cucumis sativus] Length = 237 Score = 55.1 bits (131), Expect = 9e-06 Identities = 23/52 (44%), Positives = 37/52 (71%) Frame = +2 Query: 20 PQQPVTEPFLVKHLGHSSQEKERVQAVGAYRKRRGWTSRPGLQLPAVTTTPS 175 P + + P K +SQE++R+QA+ YR R+GWTSRPG+Q+P++T +P+ Sbjct: 185 PLKLLAVPKAFKSAQVASQERKRLQAINEYRNRKGWTSRPGIQIPSMTISPA 236 >ref|XP_004144999.1| PREDICTED: uncharacterized protein LOC101205981 [Cucumis sativus] gi|449473473|ref|XP_004153891.1| PREDICTED: uncharacterized protein LOC101210645 [Cucumis sativus] Length = 232 Score = 55.1 bits (131), Expect = 9e-06 Identities = 23/52 (44%), Positives = 37/52 (71%) Frame = +2 Query: 20 PQQPVTEPFLVKHLGHSSQEKERVQAVGAYRKRRGWTSRPGLQLPAVTTTPS 175 P + + P K +SQE++R+QA+ YR R+GWTSRPG+Q+P++T +P+ Sbjct: 180 PLKLLAVPKAFKSAQVASQERKRLQAINEYRNRKGWTSRPGIQIPSMTISPA 231