BLASTX nr result
ID: Jatropha_contig00046720
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00046720 (682 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA30522.1| ORF 143 [Glycine max] 116 8e-47 gb|AFK49064.1| unknown [Lotus japonicus] 147 4e-33 ref|YP_001023675.1| ribosomal protein S12 [Angiopteris evecta] g... 130 4e-28 gb|ADA69901.1| ribsomal protein S12 [Cynomorium songaricum] 129 8e-28 gb|ADB24090.1| ribosomal protein S12 [Cynomorium songaricum] 129 1e-27 gb|ABU85255.1| ribosomal protein S12 [Cycas micronesica] 129 1e-27 ref|YP_001312168.1| ribosomal protein S12 [Cycas taitungensis] g... 129 1e-27 ref|YP_209505.1| ribosomal protein S12 [Huperzia lucidula] gi|60... 128 1e-27 gb|ERM95251.1| hypothetical protein AMTR_s02071p00004290 [Ambore... 128 2e-27 ref|YP_008575136.1| ribosomal protein S12 (chloroplast) [Eucalyp... 128 2e-27 ref|YP_008592687.1| ribosomal protein S12 (chloroplast) [Berberi... 128 2e-27 gb|AEX99538.1| ribosomal protein S12 (chloroplast) [Chrysanthemu... 128 2e-27 ref|YP_007353745.1| ribosomal protein S12 (chloroplast) [Chrysan... 128 2e-27 ref|YP_398308.1| ribosomal protein S12 [Lactuca sativa] gi|81176... 128 2e-27 gb|AEQ37137.1| ribosomal protein S12 (chloroplast) [Ginkgo bilob... 128 2e-27 ref|YP_006503815.1| ribosomal protein S12 (chloroplast) [Datura ... 128 2e-27 ref|YP_005352684.1| rps12 gene product (chloroplast) [Ginkgo bil... 128 2e-27 gb|AEZ49088.1| ribosomal protein S12 [Apostasia wallichii] 128 2e-27 gb|AEX94120.1| ribosomal protein S12 (chloroplast) [Dasylirion w... 128 2e-27 gb|AEX94119.1| ribosomal protein S12 (chloroplast) [Calibanus ho... 128 2e-27 >emb|CAA30522.1| ORF 143 [Glycine max] Length = 143 Score = 116 bits (290), Expect(2) = 8e-47 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = -1 Query: 184 LHYFGNPRTQSYGYVKYRIFNPSRKRKERDTQFKVSKQNSILDLIDTYRILWKAVFDESR 5 LHYFGNPRTQSYGYVKYRI NPSRKR DTQF+VSKQNSILD+IDTYRILWKAVFDESR Sbjct: 60 LHYFGNPRTQSYGYVKYRISNPSRKRGGTDTQFQVSKQNSILDIIDTYRILWKAVFDESR 119 Query: 4 M 2 M Sbjct: 120 M 120 Score = 97.8 bits (242), Expect(2) = 8e-47 Identities = 51/65 (78%), Positives = 55/65 (84%) Frame = -2 Query: 375 VKQKIFFLKRFDSELLYVQGPILE*FQRFSLTLSASTKSTNNSKCLDFFRTGPSQIAMIR 196 ++QKIFFLK+FDSEL YVQGPI + FQRFSLTLS STNNSKCLDFFR GPSQIAMIR Sbjct: 1 MRQKIFFLKKFDSELRYVQGPIWKEFQRFSLTLSV---STNNSKCLDFFRIGPSQIAMIR 57 Query: 195 STSFY 181 ST Y Sbjct: 58 STLHY 62 >gb|AFK49064.1| unknown [Lotus japonicus] Length = 128 Score = 147 bits (370), Expect = 4e-33 Identities = 82/110 (74%), Positives = 87/110 (79%) Frame = -1 Query: 331 IICPRSNIGIISEVFLDFVRVNKVNKQFEMPRLF*NRSESNSNDSKHFFLHYFGNPRTQS 152 +ICPRSNI ISEVFLDFVRVNK QFEMPRLF R + LHYF N RTQS Sbjct: 1 MICPRSNIERISEVFLDFVRVNK---QFEMPRLF--RLGPSQIAMIRSTLHYFENLRTQS 55 Query: 151 YGYVKYRIFNPSRKRKERDTQFKVSKQNSILDLIDTYRILWKAVFDESRM 2 YGYVKYRI NPS+KR+E DTQF+VSKQNSILDLIDTYRIL KAVFDESRM Sbjct: 56 YGYVKYRISNPSKKRRETDTQFQVSKQNSILDLIDTYRILRKAVFDESRM 105 >ref|YP_001023675.1| ribosomal protein S12 [Angiopteris evecta] gi|110628328|gb|ABG79624.1| ribosomal protein S12 [Angiopteris evecta] Length = 129 Score = 130 bits (327), Expect = 4e-28 Identities = 65/72 (90%), Positives = 67/72 (93%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHN QEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDR+QGRS Sbjct: 56 RLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRKQGRS 115 Query: 501 SAL*ILIQDLYH 466 SAL +I LYH Sbjct: 116 SALYNIIYHLYH 127 >gb|ADA69901.1| ribsomal protein S12 [Cynomorium songaricum] Length = 84 Score = 129 bits (324), Expect = 8e-28 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHN QEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS Sbjct: 18 RLTSGFEITAYIPGIGHNXQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 77 Query: 501 SAL*ILI 481 SAL ILI Sbjct: 78 SALYILI 84 >gb|ADB24090.1| ribosomal protein S12 [Cynomorium songaricum] Length = 84 Score = 129 bits (323), Expect = 1e-27 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHN QEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS Sbjct: 18 RLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 77 Query: 501 SAL*ILI 481 SAL ILI Sbjct: 78 SALYILI 84 >gb|ABU85255.1| ribosomal protein S12 [Cycas micronesica] Length = 122 Score = 129 bits (323), Expect = 1e-27 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHN QEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS Sbjct: 56 RLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 115 Query: 501 SAL*ILI 481 SAL ILI Sbjct: 116 SALYILI 122 >ref|YP_001312168.1| ribosomal protein S12 [Cycas taitungensis] gi|150251557|ref|YP_001312289.1| ribosomal protein S12 [Cycas taitungensis] gi|452848920|ref|YP_007474599.1| ribosomal protein S12 (chloroplast) [Cycas revoluta] gi|452848921|ref|YP_007474630.1| ribosomal protein S12 (chloroplast) [Cycas revoluta] gi|149941572|dbj|BAF64996.1| ribosomal protein S12 (chloroplast) [Cycas taitungensis] gi|372863075|gb|AEX99148.1| ribosomal protein S12 (chloroplast) [Cycas revoluta] gi|372863076|gb|AEX99149.1| ribosomal protein S12 (chloroplast) [Cycas revoluta] Length = 122 Score = 129 bits (323), Expect = 1e-27 Identities = 65/67 (97%), Positives = 65/67 (97%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHN QEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS Sbjct: 56 RLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 115 Query: 501 SAL*ILI 481 SAL ILI Sbjct: 116 SALYILI 122 >ref|YP_209505.1| ribosomal protein S12 [Huperzia lucidula] gi|60139438|ref|YP_209614.1| ribosomal protein S12 [Huperzia lucidula] Length = 122 Score = 128 bits (322), Expect = 1e-27 Identities = 64/67 (95%), Positives = 66/67 (98%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVK+RQQGRS Sbjct: 56 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKNRQQGRS 115 Query: 501 SAL*ILI 481 SAL I+I Sbjct: 116 SALYIII 122 >gb|ERM95251.1| hypothetical protein AMTR_s02071p00004290 [Amborella trichopoda] Length = 140 Score = 128 bits (321), Expect = 2e-27 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS Sbjct: 78 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 137 Query: 501 SAL 493 SAL Sbjct: 138 SAL 140 >ref|YP_008575136.1| ribosomal protein S12 (chloroplast) [Eucalyptus obliqua] gi|545716355|ref|YP_008575221.1| ribosomal protein S12 (chloroplast) [Eucalyptus radiata] gi|545716441|ref|YP_008575306.1| ribosomal protein S12 (chloroplast) [Eucalyptus delegatensis] gi|545716527|ref|YP_008575391.1| ribosomal protein S12 (chloroplast) [Eucalyptus verrucata] gi|545716613|ref|YP_008575476.1| ribosomal protein S12 (chloroplast) [Eucalyptus baxteri] gi|545716699|ref|YP_008575561.1| ribosomal protein S12 (chloroplast) [Eucalyptus diversifolia] gi|545716785|ref|YP_008575646.1| ribosomal protein S12 (chloroplast) [Eucalyptus sieberi] gi|545716871|ref|YP_008575731.1| ribosomal protein S12 (chloroplast) [Eucalyptus elata] gi|545716957|ref|YP_008575816.1| ribosomal protein S12 (chloroplast) [Eucalyptus regnans] gi|545717043|ref|YP_008575901.1| ribosomal protein S12 (chloroplast) [Eucalyptus umbra] gi|545717129|ref|YP_008575986.1| ribosomal protein S12 (chloroplast) [Eucalyptus cloeziana] gi|545717215|ref|YP_008576071.1| ribosomal protein S12 (chloroplast) [Eucalyptus patens] gi|545717301|ref|YP_008576156.1| ribosomal protein S12 (chloroplast) [Eucalyptus marginata] gi|545717387|ref|YP_008576241.1| ribosomal protein S12 (chloroplast) [Eucalyptus curtisii] gi|545717473|ref|YP_008576326.1| ribosomal protein S12 (chloroplast) [Eucalyptus melliodora] gi|545717559|ref|YP_008576411.1| ribosomal protein S12 (chloroplast) [Eucalyptus polybractea] gi|545717645|ref|YP_008576496.1| ribosomal protein S12 (chloroplast) [Eucalyptus cladocalyx] gi|545717731|ref|YP_008576581.1| ribosomal protein S12 (chloroplast) [Eucalyptus nitens] gi|545717817|ref|YP_008576666.1| ribosomal protein S12 (chloroplast) [Eucalyptus aromaphloia] gi|545717903|ref|YP_008576751.1| ribosomal protein S12 (chloroplast) [Eucalyptus saligna] gi|545717989|ref|YP_008576836.1| ribosomal protein S12 (chloroplast) [Eucalyptus camaldulensis] gi|545718075|ref|YP_008576921.1| ribosomal protein S12 (chloroplast) [Eucalyptus deglupta] gi|545718161|ref|YP_008577006.1| ribosomal protein S12 (chloroplast) [Eucalyptus spathulata] gi|545718247|ref|YP_008577091.1| ribosomal protein S12 (chloroplast) [Eucalyptus torquata] gi|545718333|ref|YP_008577176.1| ribosomal protein S12 (chloroplast) [Eucalyptus diversicolor] gi|545718419|ref|YP_008577261.1| ribosomal protein S12 (chloroplast) [Eucalyptus salmonophloia] gi|545718505|ref|YP_008577346.1| ribosomal protein S12 (chloroplast) [Eucalyptus microcorys] gi|545718591|ref|YP_008577431.1| ribosomal protein S12 (chloroplast) [Eucalyptus guilfoylei] gi|545718677|ref|YP_008577516.1| ribosomal protein S12 (chloroplast) [Eucalyptus erythrocorys] gi|545718763|ref|YP_008577601.1| ribosomal protein S12 (chloroplast) [Corymbia gummifera] gi|545718849|ref|YP_008577686.1| ribosomal protein S12 (chloroplast) [Corymbia maculata] gi|545718935|ref|YP_008577771.1| ribosomal protein S12 (chloroplast) [Corymbia eximia] gi|545719021|ref|YP_008577856.1| ribosomal protein S12 (chloroplast) [Corymbia tessellaris] gi|545719107|ref|YP_008577941.1| ribosomal protein S12 (chloroplast) [Angophora floribunda] gi|545719193|ref|YP_008578026.1| ribosomal protein S12 (chloroplast) [Angophora costata] gi|545719279|ref|YP_008578196.1| ribosomal protein S12 (chloroplast) [Stockwellia quadrifida] gi|545719451|ref|YP_008578111.1| ribosomal protein S12 (chloroplast) [Allosyncarpia ternata] gi|442566177|gb|AGC56376.1| ribosomal protein S12 (chloroplast) [Eucalyptus obliqua] gi|442566263|gb|AGC56461.1| ribosomal protein S12 (chloroplast) [Eucalyptus radiata] gi|442566349|gb|AGC56546.1| ribosomal protein S12 (chloroplast) [Eucalyptus delegatensis] gi|442566435|gb|AGC56631.1| ribosomal protein S12 (chloroplast) [Eucalyptus verrucata] gi|442566521|gb|AGC56716.1| ribosomal protein S12 (chloroplast) [Eucalyptus baxteri] gi|442566607|gb|AGC56801.1| ribosomal protein S12 (chloroplast) [Eucalyptus diversifolia] gi|442566693|gb|AGC56886.1| ribosomal protein S12 (chloroplast) [Eucalyptus sieberi] gi|442566779|gb|AGC56971.1| ribosomal protein S12 (chloroplast) [Eucalyptus elata] gi|442566865|gb|AGC57056.1| ribosomal protein S12 (chloroplast) [Eucalyptus regnans] gi|442566951|gb|AGC57141.1| ribosomal protein S12 (chloroplast) [Eucalyptus umbra] gi|442567037|gb|AGC57226.1| ribosomal protein S12 (chloroplast) [Eucalyptus cloeziana] gi|442567123|gb|AGC57311.1| ribosomal protein S12 (chloroplast) [Eucalyptus patens] gi|442567209|gb|AGC57396.1| ribosomal protein S12 (chloroplast) [Eucalyptus marginata] gi|442567295|gb|AGC57481.1| ribosomal protein S12 (chloroplast) [Eucalyptus curtisii] gi|442567381|gb|AGC57566.1| ribosomal protein S12 (chloroplast) [Eucalyptus melliodora] gi|442567467|gb|AGC57651.1| ribosomal protein S12 (chloroplast) [Eucalyptus melliodora] gi|442567553|gb|AGC57736.1| ribosomal protein S12 (chloroplast) [Eucalyptus polybractea] gi|442567639|gb|AGC57821.1| ribosomal protein S12 (chloroplast) [Eucalyptus cladocalyx] gi|442567725|gb|AGC57906.1| ribosomal protein S12 (chloroplast) [Eucalyptus globulus] gi|442567811|gb|AGC57991.1| ribosomal protein S12 (chloroplast) [Eucalyptus nitens] gi|442567897|gb|AGC58076.1| ribosomal protein S12 (chloroplast) [Eucalyptus aromaphloia] gi|442567983|gb|AGC58161.1| ribosomal protein S12 (chloroplast) [Eucalyptus saligna] gi|442568069|gb|AGC58246.1| ribosomal protein S12 (chloroplast) [Eucalyptus camaldulensis] gi|442568155|gb|AGC58331.1| ribosomal protein S12 (chloroplast) [Eucalyptus deglupta] gi|442568241|gb|AGC58416.1| ribosomal protein S12 (chloroplast) [Eucalyptus spathulata] gi|442568327|gb|AGC58501.1| ribosomal protein S12 (chloroplast) [Eucalyptus torquata] gi|442568413|gb|AGC58586.1| ribosomal protein S12 (chloroplast) [Eucalyptus diversicolor] gi|442568499|gb|AGC58671.1| ribosomal protein S12 (chloroplast) [Eucalyptus salmonophloia] gi|442568585|gb|AGC58756.1| ribosomal protein S12 (chloroplast) [Eucalyptus microcorys] gi|442568671|gb|AGC58841.1| ribosomal protein S12 (chloroplast) [Eucalyptus guilfoylei] gi|442568757|gb|AGC58926.1| ribosomal protein S12 (chloroplast) [Eucalyptus erythrocorys] gi|442568843|gb|AGC59011.1| ribosomal protein S12 (chloroplast) [Corymbia gummifera] gi|442568929|gb|AGC59096.1| ribosomal protein S12 (chloroplast) [Corymbia maculata] gi|442569015|gb|AGC59181.1| ribosomal protein S12 (chloroplast) [Corymbia eximia] gi|442569101|gb|AGC59266.1| ribosomal protein S12 (chloroplast) [Corymbia tessellaris] gi|442569187|gb|AGC59351.1| ribosomal protein S12 (chloroplast) [Angophora floribunda] gi|442569273|gb|AGC59436.1| ribosomal protein S12 (chloroplast) [Angophora costata] gi|442569359|gb|AGC59521.1| ribosomal protein S12 (chloroplast) [Allosyncarpia ternata] gi|442569445|gb|AGC59606.1| ribosomal protein S12 (chloroplast) [Stockwellia quadrifida] Length = 129 Score = 128 bits (321), Expect = 2e-27 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS Sbjct: 56 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 115 Query: 501 SAL 493 SAL Sbjct: 116 SAL 118 >ref|YP_008592687.1| ribosomal protein S12 (chloroplast) [Berberis bealei] gi|552546151|ref|YP_008592701.1| ribosomal protein S12 (chloroplast) [Berberis bealei] gi|536462728|gb|AGU37093.1| ribosomal protein S12 (chloroplast) [Berberis bealei] gi|536462742|gb|AGU37107.1| ribosomal protein S12 (chloroplast) [Berberis bealei] Length = 79 Score = 128 bits (321), Expect = 2e-27 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS Sbjct: 17 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 76 Query: 501 SAL 493 SAL Sbjct: 77 SAL 79 >gb|AEX99538.1| ribosomal protein S12 (chloroplast) [Chrysanthemum indicum] Length = 118 Score = 128 bits (321), Expect = 2e-27 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS Sbjct: 56 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 115 Query: 501 SAL 493 SAL Sbjct: 116 SAL 118 >ref|YP_007353745.1| ribosomal protein S12 (chloroplast) [Chrysanthemum x morifolium] gi|452849030|ref|YP_007474708.1| ribosomal protein S12 (chloroplast) [Chrysanthemum indicum] gi|372863185|gb|AEX99257.1| ribosomal protein S12 (chloroplast) [Chrysanthemum indicum] gi|372863424|gb|AEX99493.1| ribosomal protein S12 (chloroplast) [Chrysanthemum indicum] gi|375298859|gb|AFA45298.1| ribosomal protein S12 (chloroplast) [Chrysanthemum x morifolium] Length = 117 Score = 128 bits (321), Expect = 2e-27 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS Sbjct: 55 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 114 Query: 501 SAL 493 SAL Sbjct: 115 SAL 117 >ref|YP_398308.1| ribosomal protein S12 [Lactuca sativa] gi|81176275|ref|YP_398307.1| ribosomal protein S12 [Lactuca sativa] gi|94502470|ref|YP_588096.1| ribosomal protein S12 [Helianthus annuus] gi|114107070|ref|YP_740181.1| ribosomal protein S12 [Liriodendron tulipifera] gi|114107105|ref|YP_740226.1| ribosomal protein S12 [Liriodendron tulipifera] gi|183217720|ref|YP_001837339.1| ribosomal protein S12 [Guizotia abyssinica] gi|183217804|ref|YP_001837384.1| ribosomal protein S12 [Guizotia abyssinica] gi|334701781|ref|YP_004564351.1| ribosomal protein S12 (chloroplast) [Ageratina adenophora] gi|334701826|ref|YP_004564396.1| ribosomal protein S12 (chloroplast) [Ageratina adenophora] gi|394831125|ref|YP_006503770.1| ribosomal protein S12 (chloroplast) [Datura stramonium] gi|441403317|ref|YP_007353790.1| ribosomal protein S12 (chloroplast) [Chrysanthemum x morifolium] gi|452849075|ref|YP_007474753.1| ribosomal protein S12 (chloroplast) [Chrysanthemum indicum] gi|470227732|ref|YP_007624819.1| ribosomal protein S12 (chloroplast) [Artemisia frigida] gi|470227733|ref|YP_007624774.1| ribosomal protein S12 (chloroplast) [Artemisia frigida] gi|122225262|sp|Q1KXY0.1|RR12_HELAN RecName: Full=30S ribosomal protein S12, chloroplastic gi|122246288|sp|Q0G9J5.1|RR12_LIRTU RecName: Full=30S ribosomal protein S12, chloroplastic gi|122248965|sp|Q332V3.1|RR12_LACSA RecName: Full=30S ribosomal protein S12, chloroplastic gi|78675192|dbj|BAE47618.1| ribosomal protein S12 [Lactuca sativa] gi|78675193|dbj|BAE47619.1| ribosomal protein S12 [Lactuca sativa] gi|88656874|gb|ABD47125.1| ribosomal protein S12 [Helianthus annuus] gi|88656962|gb|ABD47212.1| ribosomal protein S12 [Lactuca sativa] gi|113201018|gb|ABI32533.1| ribosomal protein S12 [Liriodendron tulipifera] gi|113201053|gb|ABI32568.1| ribosomal protein S12 [Liriodendron tulipifera] gi|179366235|gb|ACB86506.1| ribosomal protein S12 [Guizotia abyssinica] gi|179366319|gb|ACB86590.1| ribosomal protein S12 [Guizotia abyssinica] gi|334089652|gb|AEG64535.1| ribosomal protein S12 (chloroplast) [Ageratina adenophora] gi|334089697|gb|AEG64580.1| ribosomal protein S12 (chloroplast) [Ageratina adenophora] gi|350996536|gb|AEQ37047.1| ribosomal protein S12 [Datura stramonium] gi|372480861|gb|AEX94110.1| ribosomal protein S12 (chloroplast) [Doryanthes palmeri] gi|372480875|gb|AEX94117.1| ribosomal protein S12 (chloroplast) [Iris tenax] gi|372480910|gb|AEX94134.1| ribosomal protein S12 (chloroplast) [Xeronema callistemon] gi|372863230|gb|AEX99302.1| ribosomal protein S12 (chloroplast) [Chrysanthemum indicum] gi|374412247|gb|AEZ49100.1| ribosomal protein S12 [Iris virginica] gi|375298860|gb|AFA45299.1| ribosomal protein S12 (chloroplast) [Chrysanthemum x morifolium] gi|401712220|gb|AFP98845.1| ribosomal protein S12 (chloroplast) [Artemisia frigida] gi|401712221|gb|AFP98846.1| ribosomal protein S12 (chloroplast) [Artemisia frigida] gi|559768039|gb|AHB14481.1| ribosomal protein S12 [Helianthus giganteus] gi|559768074|gb|AHB14516.1| ribosomal protein S12 [Helianthus giganteus] gi|559768125|gb|AHB14566.1| ribosomal protein S12 [Helianthus giganteus] gi|559768148|gb|AHB14589.1| ribosomal protein S12 [Helianthus giganteus] gi|559768211|gb|AHB14651.1| ribosomal protein S12 [Helianthus giganteus] gi|559768234|gb|AHB14674.1| ribosomal protein S12 [Helianthus giganteus] gi|559768297|gb|AHB14736.1| ribosomal protein S12 [Helianthus giganteus] gi|559768320|gb|AHB14759.1| ribosomal protein S12 [Helianthus giganteus] gi|559768383|gb|AHB14821.1| ribosomal protein S12 [Helianthus grosseserratus] gi|559768406|gb|AHB14844.1| ribosomal protein S12 [Helianthus grosseserratus] gi|559768469|gb|AHB14906.1| ribosomal protein S12 [Helianthus grosseserratus] gi|559768492|gb|AHB14929.1| ribosomal protein S12 [Helianthus grosseserratus] gi|559768555|gb|AHB14991.1| ribosomal protein S12 [Helianthus divaricatus] gi|559768578|gb|AHB15014.1| ribosomal protein S12 [Helianthus divaricatus] gi|559768641|gb|AHB15076.1| ribosomal protein S12 [Helianthus divaricatus] gi|559768664|gb|AHB15099.1| ribosomal protein S12 [Helianthus divaricatus] gi|559768727|gb|AHB15161.1| ribosomal protein S12 [Helianthus divaricatus] gi|559768750|gb|AHB15184.1| ribosomal protein S12 [Helianthus divaricatus] gi|559768813|gb|AHB15246.1| ribosomal protein S12 [Helianthus divaricatus] gi|559768836|gb|AHB15269.1| ribosomal protein S12 [Helianthus divaricatus] gi|559768899|gb|AHB15331.1| ribosomal protein S12 [Helianthus decapetalus] gi|559768922|gb|AHB15354.1| ribosomal protein S12 [Helianthus decapetalus] gi|559768985|gb|AHB15416.1| ribosomal protein S12 [Helianthus decapetalus] gi|559769008|gb|AHB15439.1| ribosomal protein S12 [Helianthus decapetalus] gi|559769071|gb|AHB15501.1| ribosomal protein S12 [Helianthus decapetalus] gi|559769094|gb|AHB15524.1| ribosomal protein S12 [Helianthus decapetalus] gi|559769157|gb|AHB15586.1| ribosomal protein S12 [Helianthus hirsutus] gi|559769180|gb|AHB15609.1| ribosomal protein S12 [Helianthus hirsutus] gi|559769243|gb|AHB15671.1| ribosomal protein S12 [Helianthus hirsutus] gi|559769266|gb|AHB15694.1| ribosomal protein S12 [Helianthus hirsutus] gi|559769329|gb|AHB15756.1| ribosomal protein S12 [Helianthus tuberosus] gi|559769352|gb|AHB15779.1| ribosomal protein S12 [Helianthus tuberosus] gi|559769415|gb|AHB15841.1| ribosomal protein S12 [Helianthus tuberosus] gi|559769438|gb|AHB15864.1| ribosomal protein S12 [Helianthus tuberosus] gi|559769501|gb|AHB15926.1| ribosomal protein S12 [Helianthus tuberosus] gi|559769524|gb|AHB15949.1| ribosomal protein S12 [Helianthus tuberosus] gi|559769587|gb|AHB16011.1| ribosomal protein S12 [Helianthus divaricatus] gi|559769610|gb|AHB16034.1| ribosomal protein S12 [Helianthus divaricatus] gi|559769673|gb|AHB16096.1| ribosomal protein S12 [Helianthus giganteus] gi|559769696|gb|AHB16119.1| ribosomal protein S12 [Helianthus giganteus] gi|559769759|gb|AHB16181.1| ribosomal protein S12 [Helianthus giganteus] gi|559769782|gb|AHB16204.1| ribosomal protein S12 [Helianthus giganteus] gi|559769845|gb|AHB16266.1| ribosomal protein S12 [Helianthus grosseserratus] gi|559769868|gb|AHB16289.1| ribosomal protein S12 [Helianthus grosseserratus] gi|559769931|gb|AHB16351.1| ribosomal protein S12 [Helianthus grosseserratus] gi|559769954|gb|AHB16374.1| ribosomal protein S12 [Helianthus grosseserratus] gi|559770017|gb|AHB16436.1| ribosomal protein S12 [Helianthus grosseserratus] gi|559770040|gb|AHB16459.1| ribosomal protein S12 [Helianthus grosseserratus] gi|559770103|gb|AHB16521.1| ribosomal protein S12 [Helianthus grosseserratus] gi|559770126|gb|AHB16544.1| ribosomal protein S12 [Helianthus grosseserratus] gi|559770189|gb|AHB16606.1| ribosomal protein S12 [Helianthus decapetalus] gi|559770212|gb|AHB16629.1| ribosomal protein S12 [Helianthus decapetalus] gi|559770275|gb|AHB16691.1| ribosomal protein S12 [Helianthus decapetalus] gi|559770298|gb|AHB16714.1| ribosomal protein S12 [Helianthus decapetalus] gi|559770361|gb|AHB16776.1| ribosomal protein S12 [Helianthus decapetalus] gi|559770384|gb|AHB16799.1| ribosomal protein S12 [Helianthus decapetalus] gi|559770447|gb|AHB16861.1| ribosomal protein S12 [Helianthus hirsutus] gi|559770470|gb|AHB16884.1| ribosomal protein S12 [Helianthus hirsutus] gi|559770533|gb|AHB16946.1| ribosomal protein S12 [Helianthus hirsutus] gi|559770556|gb|AHB16969.1| ribosomal protein S12 [Helianthus hirsutus] gi|559770619|gb|AHB17031.1| ribosomal protein S12 [Helianthus strumosus] gi|559770642|gb|AHB17054.1| ribosomal protein S12 [Helianthus strumosus] gi|559770705|gb|AHB17116.1| ribosomal protein S12 [Helianthus tuberosus] gi|559770728|gb|AHB17139.1| ribosomal protein S12 [Helianthus tuberosus] gi|559770791|gb|AHB17201.1| ribosomal protein S12 [Helianthus tuberosus] gi|559770814|gb|AHB17224.1| ribosomal protein S12 [Helianthus tuberosus] gi|559770877|gb|AHB17286.1| ribosomal protein S12 [Helianthus tuberosus] gi|559770900|gb|AHB17309.1| ribosomal protein S12 [Helianthus tuberosus] gi|559770963|gb|AHB17371.1| ribosomal protein S12 [Helianthus maximiliani] gi|559770986|gb|AHB17394.1| ribosomal protein S12 [Helianthus maximiliani] gi|559771049|gb|AHB17456.1| ribosomal protein S12 [Helianthus maximiliani] gi|559771072|gb|AHB17479.1| ribosomal protein S12 [Helianthus maximiliani] gi|559771135|gb|AHB17541.1| ribosomal protein S12 [Helianthus maximiliani] gi|559771158|gb|AHB17564.1| ribosomal protein S12 [Helianthus maximiliani] gi|559771221|gb|AHB17626.1| ribosomal protein S12 [Helianthus maximiliani] gi|559771244|gb|AHB17649.1| ribosomal protein S12 [Helianthus maximiliani] Length = 118 Score = 128 bits (321), Expect = 2e-27 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS Sbjct: 56 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 115 Query: 501 SAL 493 SAL Sbjct: 116 SAL 118 >gb|AEQ37137.1| ribosomal protein S12 (chloroplast) [Ginkgo biloba] gi|350996664|gb|AEQ37174.1| ribosomal protein S12 (chloroplast) [Ginkgo biloba] Length = 141 Score = 128 bits (321), Expect = 2e-27 Identities = 64/67 (95%), Positives = 65/67 (97%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHN QEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS Sbjct: 75 RLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 134 Query: 501 SAL*ILI 481 SAL I+I Sbjct: 135 SALYIII 141 >ref|YP_006503815.1| ribosomal protein S12 (chloroplast) [Datura stramonium] gi|350996572|gb|AEQ37083.1| ribosomal protein S12 [Datura stramonium] Length = 137 Score = 128 bits (321), Expect = 2e-27 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS Sbjct: 75 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 134 Query: 501 SAL 493 SAL Sbjct: 135 SAL 137 >ref|YP_005352684.1| rps12 gene product (chloroplast) [Ginkgo biloba] gi|380448727|ref|YP_005352731.1| rps12 gene product (chloroplast) [Ginkgo biloba] gi|372862315|gb|AEX98397.1| ribosomal protein S12 (chloroplast) [Ginkgo biloba] gi|372862362|gb|AEX98444.1| ribosomal protein S12 (chloroplast) [Ginkgo biloba] gi|372862738|gb|AEX98815.1| ribosomal protein S12 (chloroplast) [Ginkgo biloba] gi|372862784|gb|AEX98861.1| ribosomal protein S12 (chloroplast) [Ginkgo biloba] gi|372862907|gb|AEX98982.1| ribosomal protein S12 (chloroplast) [Ginkgo biloba] gi|372862954|gb|AEX99029.1| ribosomal protein S12 (chloroplast) [Ginkgo biloba] Length = 122 Score = 128 bits (321), Expect = 2e-27 Identities = 64/67 (95%), Positives = 65/67 (97%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHN QEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS Sbjct: 56 RLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 115 Query: 501 SAL*ILI 481 SAL I+I Sbjct: 116 SALYIII 122 >gb|AEZ49088.1| ribosomal protein S12 [Apostasia wallichii] Length = 118 Score = 128 bits (321), Expect = 2e-27 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS Sbjct: 56 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 115 Query: 501 SAL 493 SAL Sbjct: 116 SAL 118 >gb|AEX94120.1| ribosomal protein S12 (chloroplast) [Dasylirion wheeleri] gi|372480886|gb|AEX94122.1| ribosomal protein S12 (chloroplast) [Liriope spicata] gi|372480888|gb|AEX94123.1| ribosomal protein S12 (chloroplast) [Ophiopogon japonicus] gi|372480890|gb|AEX94124.1| ribosomal protein S12 (chloroplast) [Ruscus aculeatus] gi|372480892|gb|AEX94125.1| ribosomal protein S12 (chloroplast) [Sansevieria trifasciata] gi|372480894|gb|AEX94126.1| ribosomal protein S12 (chloroplast) [Maianthemum stellatum] gi|374412265|gb|AEZ49109.1| ribosomal protein S12 [Nolina atopocarpa] Length = 118 Score = 128 bits (321), Expect = 2e-27 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS Sbjct: 56 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 115 Query: 501 SAL 493 SAL Sbjct: 116 SAL 118 >gb|AEX94119.1| ribosomal protein S12 (chloroplast) [Calibanus hookeri] Length = 118 Score = 128 bits (321), Expect = 2e-27 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = -2 Query: 681 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 502 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS Sbjct: 56 RLTSGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRS 115 Query: 501 SAL 493 SAL Sbjct: 116 SAL 118