BLASTX nr result
ID: Jatropha_contig00046560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00046560 (165 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003614396.1| hypothetical protein MTR_5g051150 [Medicago ... 64 7e-16 ref|XP_003614383.1| hypothetical protein MTR_5g051000 [Medicago ... 64 7e-16 ref|XP_003614394.1| hypothetical protein MTR_5g051130 [Medicago ... 64 8e-16 ref|XP_003614382.1| hypothetical protein MTR_5g050970 [Medicago ... 64 8e-16 ref|XP_003614386.1| hypothetical protein MTR_5g051030 [Medicago ... 64 8e-16 ref|XP_003614381.1| hypothetical protein MTR_5g050960 [Medicago ... 64 8e-16 ref|XP_003614399.1| hypothetical protein MTR_5g051180 [Medicago ... 64 8e-16 gb|AFK36365.1| unknown [Lotus japonicus] 64 8e-16 gb|ACJ85262.1| unknown [Medicago truncatula] gi|388499474|gb|AFK... 64 8e-16 ref|XP_003614395.1| hypothetical protein MTR_5g051140 [Medicago ... 63 1e-15 ref|XP_003614384.1| hypothetical protein MTR_5g051010 [Medicago ... 63 1e-15 ref|XP_003614388.1| hypothetical protein MTR_5g051050, partial [... 62 2e-15 ref|XP_003541219.1| PREDICTED: uncharacterized protein LOC100796... 64 2e-15 ref|XP_003541206.1| PREDICTED: uncharacterized protein LOC100788... 64 2e-15 ref|XP_003541217.1| PREDICTED: uncharacterized protein LOC100795... 64 2e-15 ref|XP_003542256.1| PREDICTED: uncharacterized protein LOC100793... 64 2e-15 ref|XP_003541205.1| PREDICTED: uncharacterized protein LOC100787... 64 2e-15 ref|XP_003542281.1| PREDICTED: uncharacterized protein LOC100808... 64 2e-15 ref|XP_003581197.1| PREDICTED: uncharacterized protein LOC100822... 64 2e-15 ref|XP_003563149.1| PREDICTED: uncharacterized protein LOC100835... 64 2e-15 >ref|XP_003614396.1| hypothetical protein MTR_5g051150 [Medicago truncatula] gi|355515731|gb|AES97354.1| hypothetical protein MTR_5g051150 [Medicago truncatula] Length = 2133 Score = 63.5 bits (153), Expect(2) = 7e-16 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 1491 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 1527 Score = 45.4 bits (106), Expect(2) = 7e-16 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRPPK 5 PPQPNSPPDNVFRPDRP K Sbjct: 1526 PPQPNSPPDNVFRPDRPTK 1544 Score = 62.0 bits (149), Expect(2) = 2e-15 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ +L++GH+ ++LTD P Sbjct: 540 TGNQNQTSFYPFVPHEISVLVKLILGHLRYLLTDVPP 576 Score = 45.4 bits (106), Expect(2) = 2e-15 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRPPK 5 PPQPNSPPDNVFRPDRP K Sbjct: 575 PPQPNSPPDNVFRPDRPTK 593 >ref|XP_003614383.1| hypothetical protein MTR_5g051000 [Medicago truncatula] gi|355515718|gb|AES97341.1| hypothetical protein MTR_5g051000 [Medicago truncatula] Length = 1735 Score = 63.5 bits (153), Expect(2) = 7e-16 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 693 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 729 Score = 45.4 bits (106), Expect(2) = 7e-16 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRPPK 5 PPQPNSPPDNVFRPDRP K Sbjct: 728 PPQPNSPPDNVFRPDRPTK 746 >ref|XP_003614394.1| hypothetical protein MTR_5g051130 [Medicago truncatula] gi|355515729|gb|AES97352.1| hypothetical protein MTR_5g051130 [Medicago truncatula] Length = 1337 Score = 63.5 bits (153), Expect(2) = 8e-16 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 90 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 126 Score = 45.4 bits (106), Expect(2) = 8e-16 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRPPK 5 PPQPNSPPDNVFRPDRP K Sbjct: 125 PPQPNSPPDNVFRPDRPTK 143 >ref|XP_003614382.1| hypothetical protein MTR_5g050970 [Medicago truncatula] gi|355515717|gb|AES97340.1| hypothetical protein MTR_5g050970 [Medicago truncatula] Length = 1065 Score = 63.5 bits (153), Expect(2) = 8e-16 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 184 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 220 Score = 45.4 bits (106), Expect(2) = 8e-16 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRPPK 5 PPQPNSPPDNVFRPDRP K Sbjct: 219 PPQPNSPPDNVFRPDRPTK 237 >ref|XP_003614386.1| hypothetical protein MTR_5g051030 [Medicago truncatula] gi|355515721|gb|AES97344.1| hypothetical protein MTR_5g051030 [Medicago truncatula] Length = 795 Score = 63.5 bits (153), Expect(2) = 8e-16 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 91 Score = 45.4 bits (106), Expect(2) = 8e-16 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRPPK 5 PPQPNSPPDNVFRPDRP K Sbjct: 90 PPQPNSPPDNVFRPDRPTK 108 >ref|XP_003614381.1| hypothetical protein MTR_5g050960 [Medicago truncatula] gi|355515716|gb|AES97339.1| hypothetical protein MTR_5g050960 [Medicago truncatula] Length = 394 Score = 63.5 bits (153), Expect(2) = 8e-16 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 135 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 171 Score = 45.4 bits (106), Expect(2) = 8e-16 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRPPK 5 PPQPNSPPDNVFRPDRP K Sbjct: 170 PPQPNSPPDNVFRPDRPTK 188 >ref|XP_003614399.1| hypothetical protein MTR_5g051180 [Medicago truncatula] gi|355515734|gb|AES97357.1| hypothetical protein MTR_5g051180 [Medicago truncatula] Length = 237 Score = 63.5 bits (153), Expect(2) = 8e-16 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 135 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 171 Score = 45.4 bits (106), Expect(2) = 8e-16 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRPPK 5 PPQPNSPPDNVFRPDRP K Sbjct: 170 PPQPNSPPDNVFRPDRPTK 188 >gb|AFK36365.1| unknown [Lotus japonicus] Length = 157 Score = 63.5 bits (153), Expect(2) = 8e-16 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 91 Score = 45.4 bits (106), Expect(2) = 8e-16 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRPPK 5 PPQPNSPPDNVFRPDRP K Sbjct: 90 PPQPNSPPDNVFRPDRPAK 108 >gb|ACJ85262.1| unknown [Medicago truncatula] gi|388499474|gb|AFK37803.1| unknown [Medicago truncatula] Length = 157 Score = 63.5 bits (153), Expect(2) = 8e-16 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 91 Score = 45.4 bits (106), Expect(2) = 8e-16 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRPPK 5 PPQPNSPPDNVFRPDRP K Sbjct: 90 PPQPNSPPDNVFRPDRPTK 108 >ref|XP_003614395.1| hypothetical protein MTR_5g051140 [Medicago truncatula] gi|355515730|gb|AES97353.1| hypothetical protein MTR_5g051140 [Medicago truncatula] Length = 1186 Score = 62.8 bits (151), Expect(2) = 1e-15 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL+ GH+ ++LTD P Sbjct: 90 TGNQNQTSFYPFVPHEISVLVELIFGHLRYLLTDVPP 126 Score = 45.4 bits (106), Expect(2) = 1e-15 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRPPK 5 PPQPNSPPDNVFRPDRP K Sbjct: 125 PPQPNSPPDNVFRPDRPTK 143 >ref|XP_003614384.1| hypothetical protein MTR_5g051010 [Medicago truncatula] gi|355515719|gb|AES97342.1| hypothetical protein MTR_5g051010 [Medicago truncatula] Length = 1153 Score = 62.8 bits (151), Expect(2) = 1e-15 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL+ GH+ ++LTD P Sbjct: 184 TGNQNQTSFYPFVPHEISVLVELIFGHLRYLLTDVPP 220 Score = 45.4 bits (106), Expect(2) = 1e-15 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRPPK 5 PPQPNSPPDNVFRPDRP K Sbjct: 219 PPQPNSPPDNVFRPDRPTK 237 >ref|XP_003614388.1| hypothetical protein MTR_5g051050, partial [Medicago truncatula] gi|355515723|gb|AES97346.1| hypothetical protein MTR_5g051050, partial [Medicago truncatula] Length = 596 Score = 62.0 bits (149), Expect(2) = 2e-15 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ +L++GH+ ++LTD P Sbjct: 187 TGNQNQTSFYPFVPHEISVLVKLILGHLRYLLTDVPP 223 Score = 45.4 bits (106), Expect(2) = 2e-15 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRPPK 5 PPQPNSPPDNVFRPDRP K Sbjct: 222 PPQPNSPPDNVFRPDRPTK 240 >ref|XP_003541219.1| PREDICTED: uncharacterized protein LOC100796402 [Glycine max] Length = 265 Score = 63.5 bits (153), Expect(2) = 2e-15 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 163 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 199 Score = 43.9 bits (102), Expect(2) = 2e-15 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRP 11 PPQPNSPPDNVFRPDRP Sbjct: 198 PPQPNSPPDNVFRPDRP 214 >ref|XP_003541206.1| PREDICTED: uncharacterized protein LOC100788489 [Glycine max] Length = 239 Score = 63.5 bits (153), Expect(2) = 2e-15 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 137 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 173 Score = 43.9 bits (102), Expect(2) = 2e-15 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRP 11 PPQPNSPPDNVFRPDRP Sbjct: 172 PPQPNSPPDNVFRPDRP 188 >ref|XP_003541217.1| PREDICTED: uncharacterized protein LOC100795351 [Glycine max] Length = 191 Score = 63.5 bits (153), Expect(2) = 2e-15 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 89 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 125 Score = 43.9 bits (102), Expect(2) = 2e-15 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRP 11 PPQPNSPPDNVFRPDRP Sbjct: 124 PPQPNSPPDNVFRPDRP 140 >ref|XP_003542256.1| PREDICTED: uncharacterized protein LOC100793251 [Glycine max] Length = 189 Score = 63.5 bits (153), Expect(2) = 2e-15 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 91 Score = 43.9 bits (102), Expect(2) = 2e-15 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRP 11 PPQPNSPPDNVFRPDRP Sbjct: 90 PPQPNSPPDNVFRPDRP 106 >ref|XP_003541205.1| PREDICTED: uncharacterized protein LOC100787432, partial [Glycine max] Length = 159 Score = 63.5 bits (153), Expect(2) = 2e-15 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 57 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 93 Score = 43.9 bits (102), Expect(2) = 2e-15 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRP 11 PPQPNSPPDNVFRPDRP Sbjct: 92 PPQPNSPPDNVFRPDRP 108 >ref|XP_003542281.1| PREDICTED: uncharacterized protein LOC100808462 [Glycine max] gi|356547770|ref|XP_003542282.1| PREDICTED: uncharacterized protein LOC100808996 [Glycine max] gi|356547773|ref|XP_003542283.1| PREDICTED: uncharacterized protein LOC100810077 [Glycine max] gi|356547775|ref|XP_003542284.1| PREDICTED: uncharacterized protein LOC100810602 [Glycine max] gi|356547826|ref|XP_003542306.1| PREDICTED: uncharacterized protein LOC100809185 [Glycine max] gi|561005735|gb|ESW04729.1| hypothetical protein PHAVU_011G120500g [Phaseolus vulgaris] Length = 157 Score = 63.5 bits (153), Expect(2) = 2e-15 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 91 Score = 43.9 bits (102), Expect(2) = 2e-15 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRP 11 PPQPNSPPDNVFRPDRP Sbjct: 90 PPQPNSPPDNVFRPDRP 106 >ref|XP_003581197.1| PREDICTED: uncharacterized protein LOC100822817 [Brachypodium distachyon] gi|357167592|ref|XP_003581238.1| PREDICTED: uncharacterized protein LOC100839787 [Brachypodium distachyon] gi|357167653|ref|XP_003581268.1| PREDICTED: uncharacterized protein LOC100827645 [Brachypodium distachyon] Length = 127 Score = 63.5 bits (153), Expect(2) = 2e-15 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 91 Score = 43.9 bits (102), Expect(2) = 2e-15 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRP 11 PPQPNSPPDNVFRPDRP Sbjct: 90 PPQPNSPPDNVFRPDRP 106 >ref|XP_003563149.1| PREDICTED: uncharacterized protein LOC100835815 [Brachypodium distachyon] Length = 127 Score = 63.5 bits (153), Expect(2) = 2e-15 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 165 TGNQNQTSFYPFVPHEISVVGELLIGHMGFILTDFRP 55 TGNQNQTSFYPFVPHEISV+ EL++GH+ ++LTD P Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPP 91 Score = 43.9 bits (102), Expect(2) = 2e-15 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 61 PPQPNSPPDNVFRPDRP 11 PPQPNSPPDNVFRPDRP Sbjct: 90 PPQPNSPPDNVFRPDRP 106