BLASTX nr result
ID: Jatropha_contig00046417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00046417 (276 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP61464.1| hypothetical protein POPTR_0005s23390g [Populus t... 67 2e-09 ref|XP_002524752.1| nucleolar protein nop56, putative [Ricinus c... 67 2e-09 emb|CBI28721.3| unnamed protein product [Vitis vinifera] 65 9e-09 ref|XP_003632318.1| PREDICTED: vicilin-like antimicrobial peptid... 65 9e-09 emb|CBI28722.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_003632338.1| PREDICTED: vicilin-like antimicrobial peptid... 57 2e-06 gb|AAM73730.2|AF395894_1 vicilin-like protein [Anacardium occide... 55 7e-06 gb|AAM73729.1|AF395893_1 vicilin-like protein [Anacardium occide... 55 7e-06 >gb|ERP61464.1| hypothetical protein POPTR_0005s23390g [Populus trichocarpa] gi|550339592|gb|EEE93780.2| hypothetical protein POPTR_0005s23390g [Populus trichocarpa] Length = 544 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/51 (58%), Positives = 40/51 (78%) Frame = +2 Query: 2 KNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRGSFEGHAVA 154 K N++ +M+++AKELA+GV +EVDQ FG+Q EE+FFPGPRR EG A A Sbjct: 494 KWNVIGEMDREAKELAYGVPAKEVDQIFGKQQEEFFFPGPRRQRREGRAYA 544 >ref|XP_002524752.1| nucleolar protein nop56, putative [Ricinus communis] gi|223535936|gb|EEF37595.1| nucleolar protein nop56, putative [Ricinus communis] Length = 560 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = +2 Query: 2 KNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRGSFEGHAVA 154 +NNIV + E++AKELAFGV REVD+ F QNE +FFPGPRR ++G A A Sbjct: 510 RNNIVRRWEREAKELAFGVRAREVDEVFESQNEVFFFPGPRRQEWQGRASA 560 >emb|CBI28721.3| unnamed protein product [Vitis vinifera] Length = 399 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +2 Query: 8 NIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRG 130 NIVN +EK+AKELAF + REVD+ F +QNE WFFPGPR G Sbjct: 355 NIVNALEKEAKELAFSIPAREVDEVFAKQNEWWFFPGPRGG 395 >ref|XP_003632318.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Vitis vinifera] Length = 562 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +2 Query: 8 NIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRG 130 NIVN +EK+AKELAF + REVD+ F +QNE WFFPGPR G Sbjct: 518 NIVNALEKEAKELAFSIPAREVDEVFAKQNEWWFFPGPRGG 558 >emb|CBI28722.3| unnamed protein product [Vitis vinifera] Length = 1361 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +2 Query: 2 KNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRGSFEGH 145 K N+VN +EK+AKELAF + REVD+ F +Q EE FFPGP+ + H Sbjct: 521 KGNVVNGLEKEAKELAFALPAREVDKVFRKQKEELFFPGPQLQKQQHH 568 >ref|XP_003632338.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Vitis vinifera] Length = 520 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +2 Query: 2 KNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRGSFEGH 145 K N+VN +EK+AKELAF + REVD+ F +Q EE FFPGP+ + H Sbjct: 464 KGNVVNGLEKEAKELAFALPAREVDKVFRKQKEELFFPGPQLQKQQHH 511 >gb|AAM73730.2|AF395894_1 vicilin-like protein [Anacardium occidentale] Length = 538 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = +2 Query: 2 KNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPR-RGSFEGHA 148 K NI+ MEK+AKELAF + EVD+ FG+Q+EE+FF GP R EG A Sbjct: 487 KKNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRA 536 >gb|AAM73729.1|AF395893_1 vicilin-like protein [Anacardium occidentale] Length = 536 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = +2 Query: 2 KNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPR-RGSFEGHA 148 K NI+ MEK+AKELAF + EVD+ FG+Q+EE+FF GP R EG A Sbjct: 485 KKNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRA 534