BLASTX nr result
ID: Jatropha_contig00046393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00046393 (264 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527893.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 >ref|XP_002527893.1| conserved hypothetical protein [Ricinus communis] gi|223532744|gb|EEF34524.1| conserved hypothetical protein [Ricinus communis] Length = 253 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +2 Query: 2 DPADRRSRTQVNGKVLEDVNGVHNDTNAMNGV 97 DPAD R RTQVNGK+LED NGVH DTN MNGV Sbjct: 222 DPADWRQRTQVNGKILEDANGVHADTNGMNGV 253