BLASTX nr result
ID: Jatropha_contig00046068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00046068 (717 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522162.1| conserved hypothetical protein [Ricinus comm... 68 3e-09 gb|ESR43784.1| hypothetical protein CICLE_v10012184mg [Citrus cl... 60 2e-08 gb|ESR43783.1| hypothetical protein CICLE_v10012184mg [Citrus cl... 60 2e-08 gb|ESR43785.1| hypothetical protein CICLE_v10012184mg [Citrus cl... 59 3e-07 gb|EOY08828.1| Ubiquitin-associated (UBA) protein isoform 1 [The... 55 2e-06 gb|EOY08830.1| Ubiquitin-associated domain-containing protein 2 ... 55 2e-06 gb|AAD11995.1| unknown protein [Arabidopsis thaliana] 52 5e-06 gb|ABP98986.1| putative ubiquitin associated/TS-N domain-contain... 54 6e-06 >ref|XP_002522162.1| conserved hypothetical protein [Ricinus communis] gi|223538600|gb|EEF40203.1| conserved hypothetical protein [Ricinus communis] Length = 289 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +2 Query: 464 ADNAPVTRIFVIACAIFTLSFGIQGGFTKLGLSYQ 568 +DNAPVTR FVIACAIFTLSFGIQGGF KLGLSYQ Sbjct: 6 SDNAPVTRTFVIACAIFTLSFGIQGGFRKLGLSYQ 40 >gb|ESR43784.1| hypothetical protein CICLE_v10012184mg [Citrus clementina] Length = 326 Score = 60.5 bits (145), Expect(2) = 2e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 467 DNAPVTRIFVIACAIFTLSFGIQGGFTKLGLSYQ 568 DNAPVTR FVIACA+FT+ FGIQG F KLGLSYQ Sbjct: 43 DNAPVTRAFVIACALFTVFFGIQGRFNKLGLSYQ 76 Score = 25.0 bits (53), Expect(2) = 2e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +3 Query: 333 MNGGPSGFSAF 365 MNGGPSGFS + Sbjct: 1 MNGGPSGFSTY 11 >gb|ESR43783.1| hypothetical protein CICLE_v10012184mg [Citrus clementina] Length = 325 Score = 60.5 bits (145), Expect(2) = 2e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 467 DNAPVTRIFVIACAIFTLSFGIQGGFTKLGLSYQ 568 DNAPVTR FVIACA+FT+ FGIQG F KLGLSYQ Sbjct: 43 DNAPVTRAFVIACALFTVFFGIQGRFNKLGLSYQ 76 Score = 25.0 bits (53), Expect(2) = 2e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +3 Query: 333 MNGGPSGFSAF 365 MNGGPSGFS + Sbjct: 1 MNGGPSGFSTY 11 >gb|ESR43785.1| hypothetical protein CICLE_v10012184mg [Citrus clementina] Length = 291 Score = 58.5 bits (140), Expect(2) = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 467 DNAPVTRIFVIACAIFTLSFGIQGGFTKLGLSYQ 568 +NAPVTR FVIACA+FT+ FGIQG F KLGLSYQ Sbjct: 9 NNAPVTRAFVIACALFTVFFGIQGRFNKLGLSYQ 42 Score = 22.7 bits (47), Expect(2) = 3e-07 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +3 Query: 333 MNGGPSGFS 359 MNGGPSGF+ Sbjct: 1 MNGGPSGFN 9 >gb|EOY08828.1| Ubiquitin-associated (UBA) protein isoform 1 [Theobroma cacao] gi|508716934|gb|EOY08831.1| Ubiquitin-associated (UBA) protein isoform 1 [Theobroma cacao] Length = 293 Score = 55.5 bits (132), Expect(2) = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 467 DNAPVTRIFVIACAIFTLSFGIQGGFTKLGLSYQ 568 +NAPVTRIF+IACA+FT+ FGIQG KLGLSYQ Sbjct: 9 NNAPVTRIFLIACALFTVFFGIQGRSFKLGLSYQ 42 Score = 22.7 bits (47), Expect(2) = 2e-06 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +3 Query: 333 MNGGPSGFS 359 MNGGPSGF+ Sbjct: 1 MNGGPSGFN 9 >gb|EOY08830.1| Ubiquitin-associated domain-containing protein 2 isoform 3 [Theobroma cacao] Length = 261 Score = 55.5 bits (132), Expect(2) = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 467 DNAPVTRIFVIACAIFTLSFGIQGGFTKLGLSYQ 568 +NAPVTRIF+IACA+FT+ FGIQG KLGLSYQ Sbjct: 9 NNAPVTRIFLIACALFTVFFGIQGRSFKLGLSYQ 42 Score = 22.7 bits (47), Expect(2) = 2e-06 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +3 Query: 333 MNGGPSGFS 359 MNGGPSGF+ Sbjct: 1 MNGGPSGFN 9 >gb|AAD11995.1| unknown protein [Arabidopsis thaliana] Length = 371 Score = 52.4 bits (124), Expect(2) = 5e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +2 Query: 467 DNAPVTRIFVIACAIFTLSFGIQGGFTKLGLSYQ 568 +NAPVT+ FVIA A+FT+ FGI+GG +KLGLSYQ Sbjct: 310 NNAPVTKAFVIATALFTVFFGIRGGSSKLGLSYQ 343 Score = 24.6 bits (52), Expect(2) = 5e-06 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +3 Query: 330 KMNGGPSGFS 359 KMNGGPSGF+ Sbjct: 301 KMNGGPSGFN 310 >gb|ABP98986.1| putative ubiquitin associated/TS-N domain-containing protein [Hieracium piloselloides] Length = 289 Score = 53.9 bits (128), Expect(2) = 6e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +2 Query: 467 DNAPVTRIFVIACAIFTLSFGIQGGFTKLGLSYQ 568 +NAP+TR FVIAC +FT+ FGIQG KLGLSYQ Sbjct: 9 NNAPITRTFVIACCLFTIVFGIQGRSNKLGLSYQ 42 Score = 22.7 bits (47), Expect(2) = 6e-06 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +3 Query: 333 MNGGPSGFS 359 MNGGPSGF+ Sbjct: 1 MNGGPSGFN 9