BLASTX nr result
ID: Jatropha_contig00046020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00046020 (147 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004513846.1| PREDICTED: uncharacterized protein LOC101505... 107 2e-21 ref|XP_004499953.1| PREDICTED: uncharacterized protein LOC101515... 107 2e-21 ref|XP_004174058.1| PREDICTED: uncharacterized protein LOC101229... 107 2e-21 gb|AFK36365.1| unknown [Lotus japonicus] 107 2e-21 ref|XP_003581197.1| PREDICTED: uncharacterized protein LOC100822... 107 2e-21 ref|XP_003563149.1| PREDICTED: uncharacterized protein LOC100835... 107 2e-21 ref|XP_003542281.1| PREDICTED: uncharacterized protein LOC100808... 107 2e-21 ref|XP_003542256.1| PREDICTED: uncharacterized protein LOC100793... 107 2e-21 ref|XP_003541219.1| PREDICTED: uncharacterized protein LOC100796... 107 2e-21 ref|XP_003541217.1| PREDICTED: uncharacterized protein LOC100795... 107 2e-21 ref|XP_003541206.1| PREDICTED: uncharacterized protein LOC100788... 107 2e-21 ref|XP_003541205.1| PREDICTED: uncharacterized protein LOC100787... 107 2e-21 ref|XP_003614399.1| hypothetical protein MTR_5g051180 [Medicago ... 107 2e-21 ref|XP_003614396.1| hypothetical protein MTR_5g051150 [Medicago ... 107 2e-21 ref|XP_003614394.1| hypothetical protein MTR_5g051130 [Medicago ... 107 2e-21 ref|XP_003614386.1| hypothetical protein MTR_5g051030 [Medicago ... 107 2e-21 ref|XP_003614383.1| hypothetical protein MTR_5g051000 [Medicago ... 107 2e-21 ref|XP_003614382.1| hypothetical protein MTR_5g050970 [Medicago ... 107 2e-21 ref|XP_003614381.1| hypothetical protein MTR_5g050960 [Medicago ... 107 2e-21 gb|ACR36970.1| unknown [Zea mays] 107 2e-21 >ref|XP_004513846.1| PREDICTED: uncharacterized protein LOC101505414 [Cicer arietinum] Length = 157 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 103 >ref|XP_004499953.1| PREDICTED: uncharacterized protein LOC101515119 [Cicer arietinum] gi|502128999|ref|XP_004500148.1| PREDICTED: uncharacterized protein LOC101513061 [Cicer arietinum] gi|502180938|ref|XP_004516722.1| PREDICTED: uncharacterized protein LOC101503288 [Cicer arietinum] gi|502181260|ref|XP_004516768.1| PREDICTED: uncharacterized protein LOC101496645 [Cicer arietinum] Length = 157 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 103 >ref|XP_004174058.1| PREDICTED: uncharacterized protein LOC101229121 [Cucumis sativus] Length = 116 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 103 >gb|AFK36365.1| unknown [Lotus japonicus] Length = 157 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 103 >ref|XP_003581197.1| PREDICTED: uncharacterized protein LOC100822817 [Brachypodium distachyon] gi|357167592|ref|XP_003581238.1| PREDICTED: uncharacterized protein LOC100839787 [Brachypodium distachyon] gi|357167653|ref|XP_003581268.1| PREDICTED: uncharacterized protein LOC100827645 [Brachypodium distachyon] Length = 127 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 103 >ref|XP_003563149.1| PREDICTED: uncharacterized protein LOC100835815 [Brachypodium distachyon] Length = 127 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 103 >ref|XP_003542281.1| PREDICTED: uncharacterized protein LOC100808462 [Glycine max] gi|356547770|ref|XP_003542282.1| PREDICTED: uncharacterized protein LOC100808996 [Glycine max] gi|356547773|ref|XP_003542283.1| PREDICTED: uncharacterized protein LOC100810077 [Glycine max] gi|356547775|ref|XP_003542284.1| PREDICTED: uncharacterized protein LOC100810602 [Glycine max] gi|356547826|ref|XP_003542306.1| PREDICTED: uncharacterized protein LOC100809185 [Glycine max] gi|561005735|gb|ESW04729.1| hypothetical protein PHAVU_011G120500g [Phaseolus vulgaris] Length = 157 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 103 >ref|XP_003542256.1| PREDICTED: uncharacterized protein LOC100793251 [Glycine max] Length = 189 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 103 >ref|XP_003541219.1| PREDICTED: uncharacterized protein LOC100796402 [Glycine max] Length = 265 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 163 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 211 >ref|XP_003541217.1| PREDICTED: uncharacterized protein LOC100795351 [Glycine max] Length = 191 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 89 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 137 >ref|XP_003541206.1| PREDICTED: uncharacterized protein LOC100788489 [Glycine max] Length = 239 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 137 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 185 >ref|XP_003541205.1| PREDICTED: uncharacterized protein LOC100787432, partial [Glycine max] Length = 159 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 57 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 105 >ref|XP_003614399.1| hypothetical protein MTR_5g051180 [Medicago truncatula] gi|355515734|gb|AES97357.1| hypothetical protein MTR_5g051180 [Medicago truncatula] Length = 237 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 135 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 183 >ref|XP_003614396.1| hypothetical protein MTR_5g051150 [Medicago truncatula] gi|355515731|gb|AES97354.1| hypothetical protein MTR_5g051150 [Medicago truncatula] Length = 2133 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 1491 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1539 Score = 105 bits (262), Expect = 6e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLV+LILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 540 TGNQNQTSFYPFVPHEISVLVKLILGHLRYLLTDVPPQPNSPPDNVFRP 588 >ref|XP_003614394.1| hypothetical protein MTR_5g051130 [Medicago truncatula] gi|355515729|gb|AES97352.1| hypothetical protein MTR_5g051130 [Medicago truncatula] Length = 1337 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 90 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 138 >ref|XP_003614386.1| hypothetical protein MTR_5g051030 [Medicago truncatula] gi|355515721|gb|AES97344.1| hypothetical protein MTR_5g051030 [Medicago truncatula] Length = 795 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 103 >ref|XP_003614383.1| hypothetical protein MTR_5g051000 [Medicago truncatula] gi|355515718|gb|AES97341.1| hypothetical protein MTR_5g051000 [Medicago truncatula] Length = 1735 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 693 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 741 >ref|XP_003614382.1| hypothetical protein MTR_5g050970 [Medicago truncatula] gi|355515717|gb|AES97340.1| hypothetical protein MTR_5g050970 [Medicago truncatula] Length = 1065 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 184 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 232 >ref|XP_003614381.1| hypothetical protein MTR_5g050960 [Medicago truncatula] gi|355515716|gb|AES97339.1| hypothetical protein MTR_5g050960 [Medicago truncatula] Length = 394 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 135 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 183 >gb|ACR36970.1| unknown [Zea mays] Length = 127 Score = 107 bits (266), Expect = 2e-21 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -1 Query: 147 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 1 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVFRP 103