BLASTX nr result
ID: Jatropha_contig00045947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00045947 (331 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ25158.1| hypothetical protein PRUPE_ppa011195mg [Prunus pe... 60 2e-07 gb|AFR59201.1| 1-Cys peroxiredoxin [Fagopyrum tataricum] 59 8e-07 ref|XP_002519297.1| Peroxiredoxin, putative [Ricinus communis] g... 59 8e-07 gb|AAL88710.1|AF484696_1 1-cys peroxiredoxin [Xerophyta viscosa] 58 1e-06 gb|ERN01958.1| hypothetical protein AMTR_s00045p00055840 [Ambore... 57 2e-06 gb|ABN46978.2| 1-cys peroxiredoxin [Nelumbo nucifera] 57 2e-06 gb|AAF12782.1|AF191099_1 1-Cys peroxiredoxin [Fagopyrum esculentum] 57 3e-06 sp|Q6E2Z6.1|REHY_MEDTR RecName: Full=1-Cys peroxiredoxin; AltNam... 56 5e-06 ref|XP_002960461.1| hypothetical protein SELMODRAFT_164163 [Sela... 55 9e-06 >gb|EMJ25158.1| hypothetical protein PRUPE_ppa011195mg [Prunus persica] Length = 220 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 NVSNEEAKKMFPQGYKTVDLPSKKEYLRFTYV 98 +VS EEAKKMFPQGYKT+DLPSKKEYLRFT V Sbjct: 189 SVSQEEAKKMFPQGYKTMDLPSKKEYLRFTTV 220 >gb|AFR59201.1| 1-Cys peroxiredoxin [Fagopyrum tataricum] Length = 219 Score = 58.5 bits (140), Expect = 8e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 NVSNEEAKKMFPQGYKTVDLPSKKEYLRFTYV 98 +VS+EEAKKMFPQGY+TVDLPSKK YLRFT V Sbjct: 188 SVSDEEAKKMFPQGYRTVDLPSKKGYLRFTQV 219 >ref|XP_002519297.1| Peroxiredoxin, putative [Ricinus communis] gi|223541612|gb|EEF43161.1| Peroxiredoxin, putative [Ricinus communis] Length = 219 Score = 58.5 bits (140), Expect = 8e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 3 NVSNEEAKKMFPQGYKTVDLPSKKEYLRFTYVD 101 +VS +EAKKMFPQGYKTVDLPS+K YLRFT VD Sbjct: 187 SVSTDEAKKMFPQGYKTVDLPSEKGYLRFTNVD 219 >gb|AAL88710.1|AF484696_1 1-cys peroxiredoxin [Xerophyta viscosa] Length = 219 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 3 NVSNEEAKKMFPQGYKTVDLPSKKEYLRFTYV 98 +VS+EEAKK+FPQGYK+VDLPSKK+YLRFT V Sbjct: 188 DVSSEEAKKLFPQGYKSVDLPSKKDYLRFTNV 219 >gb|ERN01958.1| hypothetical protein AMTR_s00045p00055840 [Amborella trichopoda] Length = 219 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 3 NVSNEEAKKMFPQGYKTVDLPSKKEYLRFTYV 98 NVS EEAKKMFPQGY+TVDLPS K YLRFT V Sbjct: 188 NVSEEEAKKMFPQGYQTVDLPSGKPYLRFTKV 219 >gb|ABN46978.2| 1-cys peroxiredoxin [Nelumbo nucifera] Length = 108 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 6 VSNEEAKKMFPQGYKTVDLPSKKEYLRFTYV 98 VSNE+AK+MFPQGYK DLPSKKEYLRFT V Sbjct: 78 VSNEQAKQMFPQGYKIADLPSKKEYLRFTNV 108 >gb|AAF12782.1|AF191099_1 1-Cys peroxiredoxin [Fagopyrum esculentum] Length = 219 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 NVSNEEAKKMFPQGYKTVDLPSKKEYLRFTYV 98 +VS+EEAKKMFP GY+TVDLPSKK YLRFT V Sbjct: 188 SVSDEEAKKMFPHGYRTVDLPSKKGYLRFTQV 219 >sp|Q6E2Z6.1|REHY_MEDTR RecName: Full=1-Cys peroxiredoxin; AltName: Full=Rehydrin homolog; AltName: Full=Thioredoxin peroxidase gi|49618728|gb|AAT67997.1| 1-cys peroxiredoxin [Medicago truncatula] Length = 218 Score = 55.8 bits (133), Expect = 5e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 3 NVSNEEAKKMFPQGYKTVDLPSKKEYLRFTYV 98 +V+N++AK+MFPQG+KT DLPSKKEYLRFT V Sbjct: 187 DVTNDQAKEMFPQGFKTADLPSKKEYLRFTNV 218 >ref|XP_002960461.1| hypothetical protein SELMODRAFT_164163 [Selaginella moellendorffii] gi|302767680|ref|XP_002967260.1| hypothetical protein SELMODRAFT_439793 [Selaginella moellendorffii] gi|300165251|gb|EFJ31859.1| hypothetical protein SELMODRAFT_439793 [Selaginella moellendorffii] gi|300171400|gb|EFJ38000.1| hypothetical protein SELMODRAFT_164163 [Selaginella moellendorffii] Length = 220 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 3 NVSNEEAKKMFPQGYKTVDLPSKKEYLRFTYVD 101 +VS+EEAKKMFPQGYKTVDLPS K+Y+R VD Sbjct: 188 SVSDEEAKKMFPQGYKTVDLPSGKKYMRLVKVD 220