BLASTX nr result
ID: Jatropha_contig00045812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00045812 (431 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588355.1| Mitochondrial protein, putative [Medicago tr... 139 2e-38 gb|EPS74717.1| hypothetical protein M569_00042, partial [Genlise... 110 2e-34 ref|WP_002430991.1| conserved hypothetical protein [Escherichia ... 65 9e-09 ref|WP_005325843.1| hypothetical protein [Corynebacterium pseudo... 65 1e-08 ref|WP_006680208.1| hypothetical protein [Actinomyces turicensis... 61 2e-07 ref|WP_001894030.1| hypothetical protein [Vibrio cholerae] gi|12... 60 2e-07 ref|YP_002730924.1| hypothetical protein PERMA_1141 [Persephonel... 58 1e-06 ref|YP_002731697.1| hypothetical protein PERMA_1937 [Persephonel... 58 1e-06 ref|WP_004923043.1| hypothetical protein [Providencia stuartii] ... 58 1e-06 ref|YP_003600535.1| hypothetical protein LCRIS_00063 [Lactobacil... 57 2e-06 ref|WP_004247155.1| hypothetical protein [Proteus mirabilis] gi|... 57 2e-06 ref|WP_021399582.1| hypothetical protein [[Clostridium] difficil... 53 5e-06 ref|WP_002744838.1| hypothetical protein [Microcystis aeruginosa... 56 5e-06 ref|YP_005855168.1| hypothetical protein LC2W_0248 [Lactobacillu... 55 7e-06 emb|CAR86202.1| Conserved protein [Lactobacillus rhamnosus GG] g... 55 7e-06 >ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477403|gb|AES58606.1| Mitochondrial protein, putative [Medicago truncatula] Length = 1106 Score = 139 bits (349), Expect(2) = 2e-38 Identities = 66/68 (97%), Positives = 67/68 (98%) Frame = -3 Query: 354 IRSFPGVGKAKWGHPSPLSALPRAIDIIRSTEIDFAENQLYPILVGLSPLATSHPRILPH 175 + SFPGVGKAKWGHPSPLSALPRAIDIIRSTEIDFAENQLYPILVGLSPLATSHPRILPH Sbjct: 800 LSSFPGVGKAKWGHPSPLSALPRAIDIIRSTEIDFAENQLYPILVGLSPLATSHPRILPH 859 Query: 174 TWVRSSKA 151 TWVRSSKA Sbjct: 860 TWVRSSKA 867 Score = 46.2 bits (108), Expect(2) = 2e-38 Identities = 21/26 (80%), Positives = 21/26 (80%), Gaps = 4/26 (15%) Frame = -2 Query: 76 HLW----KAPTPNGLSRCSHFLADPS 11 H W KAPTPNGLSRCSHFLADPS Sbjct: 859 HTWVRSSKAPTPNGLSRCSHFLADPS 884 >gb|EPS74717.1| hypothetical protein M569_00042, partial [Genlisea aurea] Length = 101 Score = 110 bits (274), Expect(2) = 2e-34 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 309 SPLSALPRAIDIIRSTEIDFAENQLYPILVGLSPLATSHPRILPHTWVRSSKAC 148 SPLSALPRAIDIIRST+IDFAENQLYPILVGLSPLATSHPRILPHTWVRSSKAC Sbjct: 48 SPLSALPRAIDIIRSTKIDFAENQLYPILVGLSPLATSHPRILPHTWVRSSKAC 101 Score = 61.2 bits (147), Expect(2) = 2e-34 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 430 RSGLFPSRLWILAPQKSVCTNDLGLYSEF 344 RSGLFPSRLWILAP+KSVCTNDLGLYS+F Sbjct: 8 RSGLFPSRLWILAPKKSVCTNDLGLYSKF 36 >ref|WP_002430991.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA] gi|226903374|gb|EEH89633.1| hypothetical protein ESAG_07158 [Escherichia sp. 3_2_53FAA] Length = 66 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/52 (61%), Positives = 36/52 (69%) Frame = -2 Query: 301 ECSTSGHRHHTLY*NRFRGKPAISDLGWPFTPSHKSSPYFATYVGSVLQGLL 146 +CST G Y N FRG+PAIS WPFTPSHKSS F+T VGSVLQ +L Sbjct: 7 QCSTPGDEFTRRYLNSFRGEPAISRFDWPFTPSHKSSANFSTLVGSVLQLVL 58 >ref|WP_005325843.1| hypothetical protein [Corynebacterium pseudogenitalium] gi|311304693|gb|EFQ80765.1| hypothetical protein HMPREF0305_11076 [Corynebacterium pseudogenitalium ATCC 33035] gi|311304793|gb|EFQ80864.1| hypothetical protein HMPREF0305_11005 [Corynebacterium pseudogenitalium ATCC 33035] Length = 74 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -2 Query: 271 TLY*NRFRGKPAISDLGWPFTPSHKSSPYFATYVGSVLQGLLELSST 131 TL+ N FRG+PAI++ WPFTP+H SSP F+TYVGS L LL+L T Sbjct: 25 TLHLNAFRGEPAITEFDWPFTPTHSSSPQFSTYVGSRLHNLLQLLHT 71 >ref|WP_006680208.1| hypothetical protein [Actinomyces turicensis] gi|404389952|gb|EJZ85023.1| hypothetical protein HMPREF9241_01603 [Actinomyces turicensis ACS-279-V-Col4] gi|404390283|gb|EJZ85352.1| hypothetical protein HMPREF9241_01352 [Actinomyces turicensis ACS-279-V-Col4] gi|404393425|gb|EJZ88479.1| hypothetical protein HMPREF9241_00001 [Actinomyces turicensis ACS-279-V-Col4] Length = 92 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +3 Query: 156 WRTEPTYVAKYGDDLWLGVKGQPRSDIAGFPRNLFQ*SV*CRWPEVE 296 WRTEPT V GD+LW+GVKGQ S IAG PRN F+ SV C EVE Sbjct: 2 WRTEPTRVENLGDELWVGVKGQSNSVIAGSPRNAFRCSVVCCLVEVE 48 >ref|WP_001894030.1| hypothetical protein [Vibrio cholerae] gi|124113458|gb|EAY32278.1| hypothetical protein A55_B0061 [Vibrio cholerae 1587] Length = 41 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +3 Query: 144 SNRPWRTEPTYVAKYGDDLWLGVKGQPRSDIAGFPRNLFQ 263 SN WRTEPT V K DDLWLGVKGQ S+IAG PR LF+ Sbjct: 2 SNINWRTEPTNVEKLADDLWLGVKGQSNSEIAGSPRKLFR 41 >ref|YP_002730924.1| hypothetical protein PERMA_1141 [Persephonella marina EX-H1] gi|501940437|ref|WP_012675883.1| hypothetical protein [Persephonella marina] gi|225645458|gb|ACO03644.1| conserved hypothetical protein [Persephonella marina EX-H1] Length = 159 Score = 58.2 bits (139), Expect = 1e-06 Identities = 36/100 (36%), Positives = 53/100 (53%), Gaps = 6/100 (6%) Frame = -3 Query: 429 DLGCFPLDFGS*HPKSLSVQTI*ACIRSFPGVGKAKWGHPSPLSALPRAIDII------R 268 DLGCFPL G+ P C +FPG+ ++ G +P AL +++ + R Sbjct: 7 DLGCFPLVHGA-DPSWTH------CRSTFPGI-RSLVGFGTPFGALAQSVSLPPGRNERR 58 Query: 267 STEIDFAENQLYPILVGLSPLATSHPRILPHTWVRSSKAC 148 T + F EN+L +G SPL+T HP +L H VR+S+ C Sbjct: 59 CTSMHFGENELSQNAIGFSPLSTPHPTVLQHRLVRASRRC 98 >ref|YP_002731697.1| hypothetical protein PERMA_1937 [Persephonella marina EX-H1] gi|501939551|ref|WP_012675523.1| hypothetical protein [Persephonella marina] gi|225645098|gb|ACO03284.1| conserved hypothetical protein [Persephonella marina EX-H1] Length = 159 Score = 57.8 bits (138), Expect = 1e-06 Identities = 36/100 (36%), Positives = 53/100 (53%), Gaps = 6/100 (6%) Frame = -3 Query: 429 DLGCFPLDFGS*HPKSLSVQTI*ACIRSFPGVGKAKWGHPSPLSALPRAIDII------R 268 DLGCFPL G+ P C +FPG+ ++ G +P AL +++ + R Sbjct: 7 DLGCFPLVHGA-DPSWTH------CRSTFPGI-RSLVGFGTPFGALAQSVSLPPGRNERR 58 Query: 267 STEIDFAENQLYPILVGLSPLATSHPRILPHTWVRSSKAC 148 T + F EN+L +G SPL+T HP +L H VR+S+ C Sbjct: 59 CTSMHFGENELSRNAIGFSPLSTPHPTVLQHRLVRASRRC 98 >ref|WP_004923043.1| hypothetical protein [Providencia stuartii] gi|188022873|gb|EDU60913.1| hypothetical protein PROSTU_01098 [Providencia stuartii ATCC 25827] Length = 41 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = +3 Query: 147 NRPWRTEPTYVAKYGDDLWLGVKGQPRSDIAGFPRNLFQ 263 N WRTEPT V K DDLWLGVKGQ +IAG PR LF+ Sbjct: 3 NTNWRTEPTNVEKLADDLWLGVKGQSNREIAGSPRKLFR 41 >ref|YP_003600535.1| hypothetical protein LCRIS_00063 [Lactobacillus crispatus ST1] gi|295692304|ref|YP_003600914.1| hypothetical protein LCRIS_00442 [Lactobacillus crispatus ST1] gi|295692317|ref|YP_003600927.1| hypothetical protein LCRIS_00455 [Lactobacillus crispatus ST1] gi|295693512|ref|YP_003602122.1| hypothetical protein LCRIS_01650 [Lactobacillus crispatus ST1] gi|502850660|ref|WP_013085636.1| hypothetical protein [Lactobacillus crispatus] gi|295030031|emb|CBL49510.1| conserved protein [Lactobacillus crispatus ST1] gi|295030410|emb|CBL49889.1| conserved protein [Lactobacillus crispatus ST1] gi|295030423|emb|CBL49902.1| conserved protein [Lactobacillus crispatus ST1] gi|295031618|emb|CBL51097.1| conserved protein [Lactobacillus crispatus ST1] Length = 156 Score = 57.0 bits (136), Expect = 2e-06 Identities = 40/95 (42%), Positives = 50/95 (52%), Gaps = 4/95 (4%) Frame = -1 Query: 428 IWAVSLSTLDLSTPKVCLYKRSRPVFGVSLGLVRRNGAT----LAH*VLYLGPSTSYALL 261 IWAVSLST DL T + PV+G +V + T L LYL A Sbjct: 2 IWAVSLSTTDLITRSLT------PVYGYLEFVVYLDSVTPDGPLVQTELYLHYPLHEASP 55 Query: 260 K*ISRKTSYIRSWLAFHP*PQVIPVFCHIRGFGPP 156 K IS +TSY++ L FH PQ+IP ++RGFGPP Sbjct: 56 KAISERTSYLQVRLEFHRYPQLIPAIFNLRGFGPP 90 >ref|WP_004247155.1| hypothetical protein [Proteus mirabilis] gi|227161375|gb|EEI46427.1| hypothetical protein HMPREF0693_3633 [Proteus mirabilis ATCC 29906] Length = 41 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = +3 Query: 147 NRPWRTEPTYVAKYGDDLWLGVKGQPRSDIAGFPRNLFQ 263 N WRTEPT V K DDLW+GVKGQ +IAG PR LF+ Sbjct: 3 NTNWRTEPTNVEKLADDLWMGVKGQSNREIAGSPRKLFR 41 >ref|WP_021399582.1| hypothetical protein [[Clostridium] difficile] gi|531382562|gb|EQG74591.1| hypothetical protein QKA_3524 [Clostridium difficile DA00165] gi|531641939|gb|EQJ20122.1| hypothetical protein QS3_0132 [Clostridium difficile P13] gi|531708916|gb|EQJ85959.1| hypothetical protein QU7_0117 [Clostridium difficile P46] gi|548681502|gb|ERM50695.1| hypothetical protein QUG_0137 [Clostridium difficile P53] gi|548683161|gb|ERM52323.1| hypothetical protein QUQ_0118 [Clostridium difficile P68] Length = 152 Score = 52.8 bits (125), Expect(2) = 5e-06 Identities = 30/53 (56%), Positives = 34/53 (64%) Frame = -1 Query: 311 LAH*VLYLGPSTSYALLK*ISRKTSYIRSWLAFHP*PQVIPVFCHIRGFGPPR 153 L H VLYL S A K IS +TSY+R+ L FH PQVIP + RGFGPPR Sbjct: 5 LGHSVLYLRISHLEASPKAISGRTSYLRARLEFHRYPQVIPELFNARGFGPPR 57 Score = 23.1 bits (48), Expect(2) = 5e-06 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -2 Query: 139 SSTCSWLDRSVSG 101 +S+CSW+ R VSG Sbjct: 62 ASSCSWVGRPVSG 74 >ref|WP_002744838.1| hypothetical protein [Microcystis aeruginosa] gi|443332438|gb|ELS47047.1| hypothetical protein C789_3192 [Microcystis aeruginosa DIANCHI905] gi|443332755|gb|ELS47348.1| hypothetical protein C789_2872 [Microcystis aeruginosa DIANCHI905] Length = 102 Score = 55.8 bits (133), Expect = 5e-06 Identities = 34/91 (37%), Positives = 48/91 (52%) Frame = +3 Query: 156 WRTEPTYVAKYGDDLWLGVKGQPRSDIAGFPRNLFQ*SV*CRWPEVEHSMG*GGPISPYQ 335 WR+EPT V K D+LWLGVK Q S++AG PRN+ + S V+H G Sbjct: 6 WRSEPTNVEKLADELWLGVKCQSNSELAGSPRNVLRRSGSGSLVGVKHCFAAGWETGTKA 65 Query: 336 PQGNSEYRPRSFVQTDFWGAKIQSREGNSPD 428 Q + + + ++ G K+ +EGNSPD Sbjct: 66 RQTLNTAKKTT---SETVGDKLHRQEGNSPD 93 >ref|YP_005855168.1| hypothetical protein LC2W_0248 [Lactobacillus casei LC2W] gi|385819441|ref|YP_005855828.1| hypothetical protein LC2W_0910 [Lactobacillus casei LC2W] gi|385819457|ref|YP_005855844.1| hypothetical protein LC2W_0926 [Lactobacillus casei LC2W] gi|385820535|ref|YP_005856922.1| hypothetical protein LC2W_2006 [Lactobacillus casei LC2W] gi|385821204|ref|YP_005857591.1| hypothetical protein LC2W_2677 [Lactobacillus casei LC2W] gi|385821956|ref|YP_005858298.1| hypothetical protein LCBD_0257 [Lactobacillus casei BD-II] gi|385822604|ref|YP_005858946.1| hypothetical protein LCBD_0907 [Lactobacillus casei BD-II] gi|385822619|ref|YP_005858961.1| hypothetical protein LCBD_0922 [Lactobacillus casei BD-II] gi|385823721|ref|YP_005860063.1| hypothetical protein LCBD_2026 [Lactobacillus casei BD-II] gi|385824397|ref|YP_005860739.1| hypothetical protein LCBD_2704 [Lactobacillus casei BD-II] gi|504379271|ref|WP_014566373.1| hypothetical protein [Lactobacillus casei] gi|327381108|gb|AEA52584.1| Conserved protein [Lactobacillus casei LC2W] gi|327381768|gb|AEA53244.1| Conserved protein [Lactobacillus casei LC2W] gi|327381784|gb|AEA53260.1| Conserved protein [Lactobacillus casei LC2W] gi|327382862|gb|AEA54338.1| Conserved protein [Lactobacillus casei LC2W] gi|327383531|gb|AEA55007.1| Conserved protein [Lactobacillus casei LC2W] gi|327384283|gb|AEA55757.1| Conserved protein [Lactobacillus casei BD-II] gi|327384931|gb|AEA56405.1| Conserved protein [Lactobacillus casei BD-II] gi|327384946|gb|AEA56420.1| Conserved protein [Lactobacillus casei BD-II] gi|327386048|gb|AEA57522.1| Conserved protein [Lactobacillus casei BD-II] gi|327386724|gb|AEA58198.1| Conserved protein [Lactobacillus casei BD-II] Length = 131 Score = 55.5 bits (132), Expect = 7e-06 Identities = 34/67 (50%), Positives = 41/67 (61%) Frame = -1 Query: 356 VFGVSLGLVRRNGATLAH*VLYLGPSTSYALLK*ISRKTSYIRSWLAFHP*PQVIPVFCH 177 VFGV L V +G L VLYL +S A K IS +TSY++ L FH PQ+IP F + Sbjct: 2 VFGVYLNSVTLDGP-LVQTVLYLHDPSSEANPKAISERTSYLQVRLEFHRYPQLIPAFFN 60 Query: 176 IRGFGPP 156 I GFGPP Sbjct: 61 IHGFGPP 67 >emb|CAR86202.1| Conserved protein [Lactobacillus rhamnosus GG] gi|257147740|emb|CAR86713.1| Conserved protein [Lactobacillus rhamnosus GG] gi|257147759|emb|CAR86732.1| Conserved protein [Lactobacillus rhamnosus GG] gi|257148810|emb|CAR87783.1| Conserved protein [Lactobacillus rhamnosus GG] gi|257149424|emb|CAR88397.1| Conserved protein [Lactobacillus rhamnosus GG] gi|257150160|emb|CAR89132.1| Conserved protein [Lactobacillus rhamnosus Lc 705] gi|257150679|emb|CAR89651.1| Conserved protein [Lactobacillus rhamnosus Lc 705] gi|257150698|emb|CAR89670.1| Conserved protein [Lactobacillus rhamnosus Lc 705] gi|257151737|emb|CAR90709.1| Conserved protein [Lactobacillus rhamnosus Lc 705] gi|257152374|emb|CAR91346.1| Conserved protein [Lactobacillus rhamnosus Lc 705] Length = 131 Score = 55.5 bits (132), Expect = 7e-06 Identities = 34/67 (50%), Positives = 41/67 (61%) Frame = -1 Query: 356 VFGVSLGLVRRNGATLAH*VLYLGPSTSYALLK*ISRKTSYIRSWLAFHP*PQVIPVFCH 177 VFGV L V +G L VLYL +S A K IS +TSY++ L FH PQ+IP F + Sbjct: 2 VFGVYLNSVTLDGP-LVQTVLYLHDPSSEANPKAISERTSYLQVRLEFHRYPQLIPAFFN 60 Query: 176 IRGFGPP 156 I GFGPP Sbjct: 61 IHGFGPP 67