BLASTX nr result
ID: Jatropha_contig00045727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00045727 (281 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516482.1| Clathrin interactor, putative [Ricinus commu... 57 2e-06 >ref|XP_002516482.1| Clathrin interactor, putative [Ricinus communis] gi|223544302|gb|EEF45823.1| Clathrin interactor, putative [Ricinus communis] Length = 562 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -3 Query: 126 PSLQTQVDLFASQSDVHPVVPATVDFFSNGDPVMQPETKTQ 4 P QTQVDLFASQ V VP+TVDFFS DPV+QPET Q Sbjct: 347 PQSQTQVDLFASQPAVSLAVPSTVDFFSTPDPVVQPETNVQ 387