BLASTX nr result
ID: Jatropha_contig00045720
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00045720 (261 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP61464.1| hypothetical protein POPTR_0005s23390g [Populus t... 62 6e-08 emb|CBI28721.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|XP_003632318.1| PREDICTED: vicilin-like antimicrobial peptid... 60 4e-07 ref|XP_002524752.1| nucleolar protein nop56, putative [Ricinus c... 59 6e-07 >gb|ERP61464.1| hypothetical protein POPTR_0005s23390g [Populus trichocarpa] gi|550339592|gb|EEE93780.2| hypothetical protein POPTR_0005s23390g [Populus trichocarpa] Length = 544 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -2 Query: 257 KMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRGSFEGHAVA 123 +M+++AKELA+GV +EVDQ FG+Q EE+FFPGPRR EG A A Sbjct: 500 EMDREAKELAYGVPAKEVDQIFGKQQEEFFFPGPRRQRREGRAYA 544 >emb|CBI28721.3| unnamed protein product [Vitis vinifera] Length = 399 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -2 Query: 260 NKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRG 147 N +EK+AKELAF + REVD+ F +QNE WFFPGPR G Sbjct: 358 NALEKEAKELAFSIPAREVDEVFAKQNEWWFFPGPRGG 395 >ref|XP_003632318.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Vitis vinifera] Length = 562 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -2 Query: 260 NKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRG 147 N +EK+AKELAF + REVD+ F +QNE WFFPGPR G Sbjct: 521 NALEKEAKELAFSIPAREVDEVFAKQNEWWFFPGPRGG 558 >ref|XP_002524752.1| nucleolar protein nop56, putative [Ricinus communis] gi|223535936|gb|EEF37595.1| nucleolar protein nop56, putative [Ricinus communis] Length = 560 Score = 58.9 bits (141), Expect = 6e-07 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -2 Query: 257 KMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRGSFEGHAVA 123 + E++AKELAFGV REVD+ F QNE +FFPGPRR ++G A A Sbjct: 516 RWEREAKELAFGVRAREVDEVFESQNEVFFFPGPRRQEWQGRASA 560