BLASTX nr result
ID: Jatropha_contig00045693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00045693 (240 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP61464.1| hypothetical protein POPTR_0005s23390g [Populus t... 56 4e-06 >gb|ERP61464.1| hypothetical protein POPTR_0005s23390g [Populus trichocarpa] gi|550339592|gb|EEE93780.2| hypothetical protein POPTR_0005s23390g [Populus trichocarpa] Length = 544 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -2 Query: 239 KELAFGVSEREVDQAFGRQNEEWFFPGPRRGSFEGHAVA 123 KELA+GV +EVDQ FG+Q EE+FFPGPRR EG A A Sbjct: 506 KELAYGVPAKEVDQIFGKQQEEFFFPGPRRQRREGRAYA 544