BLASTX nr result
ID: Jatropha_contig00045646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00045646 (214 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523179.1| protein phosphatase 2c, putative [Ricinus co... 57 2e-06 >ref|XP_002523179.1| protein phosphatase 2c, putative [Ricinus communis] gi|223537586|gb|EEF39210.1| protein phosphatase 2c, putative [Ricinus communis] Length = 328 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -2 Query: 213 CIAGLEDAQEASEKLIDEALVRGSMDDIPCIAVVF 109 CI LEDAQEA+EKLI EALVRGSMDDI CI V F Sbjct: 293 CIRDLEDAQEAAEKLIAEALVRGSMDDISCIVVTF 327