BLASTX nr result
ID: Jatropha_contig00045578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00045578 (449 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531737.1| conserved hypothetical protein [Ricinus comm... 49 3e-08 >ref|XP_002531737.1| conserved hypothetical protein [Ricinus communis] gi|223528640|gb|EEF30657.1| conserved hypothetical protein [Ricinus communis] Length = 221 Score = 48.9 bits (115), Expect(2) = 3e-08 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 93 IAKVKKLPCWGGIDKLAFKRAYLARYHTFF 182 IAKV+KLPCWGGIDK AFKRAY + +F Sbjct: 36 IAKVRKLPCWGGIDKFAFKRAYQSGAKRYF 65 Score = 34.3 bits (77), Expect(2) = 3e-08 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +1 Query: 40 EEADMPTTGQKYLFAYI 90 EEADMPTTGQK LF YI Sbjct: 10 EEADMPTTGQKSLFTYI 26