BLASTX nr result
ID: Jatropha_contig00045544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00045544 (344 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP62785.1| hypothetical protein POPTR_0004s22840g [Populus t... 60 3e-07 >gb|ERP62785.1| hypothetical protein POPTR_0004s22840g [Populus trichocarpa] Length = 245 Score = 60.1 bits (144), Expect = 3e-07 Identities = 43/96 (44%), Positives = 53/96 (55%), Gaps = 8/96 (8%) Frame = +3 Query: 81 NDFPVELG-NCPDI---DLFFDLGDSLPAGHG*KSPDM---ELYLPDMHPFLQEHAPYCS 239 NDFP LG N D+ D LG +L G P + L + D FLQ H PYCS Sbjct: 146 NDFPAVLGCNLADLGNNDFHAVLGCNLAVLGGNDFPAVLGSNLAVLDTCSFLQGHNPYCS 205 Query: 240 LAFCLLVLADHNFAVVGNFVEVHSSHHLV-YILVDC 344 LA LL L DH+ AV+ +FVE S++HL+ LVDC Sbjct: 206 LASFLLALEDHDLAVMDHFVETRSNYHLLACALVDC 241