BLASTX nr result
ID: Jatropha_contig00045503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00045503 (148 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74345.1| hypothetical protein M569_00407, partial [Genlise... 92 9e-17 >gb|EPS74345.1| hypothetical protein M569_00407, partial [Genlisea aurea] Length = 84 Score = 91.7 bits (226), Expect = 9e-17 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = -2 Query: 144 TRGLGWANLWCTGCYANSSAGQLSWYGRTAAPREILLYTSSRTRF 10 TRGLGWANLW TGCYANSSAG LSWYGRTAA REILLYTSSRTRF Sbjct: 25 TRGLGWANLWSTGCYANSSAGLLSWYGRTAAQREILLYTSSRTRF 69