BLASTX nr result
ID: Jatropha_contig00045471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00045471 (336 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEX57640.1| cytochrome c oxidase subunit 2-1 (mitochondrion) ... 97 2e-18 gb|AFZ85273.1| cytochrome c oxidase subunit 2 (mitochondrion) [G... 97 2e-18 ref|YP_006665990.1| cytochrome c oxidase subunit 2 (mitochondrio... 97 2e-18 gb|AAB88906.1| cytochrome c oxidase subunit II [Brassica rapa su... 97 2e-18 dbj|BAD83476.2| cytochrome oxidase subunit 2 (mitochondrion) [Ni... 97 2e-18 ref|NP_064061.2| cox2 gene product (mitochondrion) [Beta vulgari... 97 2e-18 ref|YP_006460161.1| cytochrome c oxidase subunit II (mitochondri... 96 6e-18 ref|YP_005090445.1| cytochrome c oxidase subunit 2, partial (mit... 95 8e-18 ref|YP_003875498.1| cytochrome c oxidase subunit 2 [Silene latif... 95 8e-18 ref|YP_717172.1| cytochrome c oxidase subunit 2 [Brassica napus]... 94 1e-17 sp|P93285.2|COX2_ARATH RecName: Full=Cytochrome c oxidase subuni... 94 1e-17 gb|AHA84973.1| cytochrome c oxidase subunit 2 (mitochondrion) [A... 94 2e-17 gb|ABB43241.1| cytochrome c oxidase subunit II [Solanum tuberosum] 94 2e-17 ref|YP_005090502.1| cytochrome c oxidase subunit 2 (mitochondrio... 93 3e-17 sp|P98012.1|COX2_BETVU RecName: Full=Cytochrome c oxidase subuni... 92 7e-17 dbj|BAD66739.1| cytochrome oxidase subunit 2 [Beta vulgaris subs... 92 7e-17 emb|CAA40875.1| NcoxII [Beta vulgaris subsp. vulgaris] gi|11269|... 92 7e-17 ref|YP_004935320.1| cytochrome c oxidase subunit 2 (mitochondrio... 92 9e-17 gb|ADG85288.1| cytochrome c oxidase subunit 2 [Silene noctiflora] 92 9e-17 ref|XP_002534951.1| cytochrome C oxidase, subunit II, putative [... 91 1e-16 >gb|AEX57640.1| cytochrome c oxidase subunit 2-1 (mitochondrion) [Raphanus sativus] Length = 260 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWV NQLIPQT Sbjct: 213 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 257 >gb|AFZ85273.1| cytochrome c oxidase subunit 2 (mitochondrion) [Gossypium hirsutum] gi|429465287|gb|AFZ85274.1| cytochrome c oxidase subunit 2 (mitochondrion) [Gossypium hirsutum] gi|429465290|gb|AFZ85275.1| cytochrome c oxidase subunit 2 (mitochondrion) [Gossypium hirsutum] Length = 260 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWV NQLIPQT Sbjct: 213 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 257 >ref|YP_006665990.1| cytochrome c oxidase subunit 2 (mitochondrion) [Raphanus sativus] gi|2687657|gb|AAB88867.1| cytochrome c oxidase subunit II [Raphanus sativus] gi|400278265|dbj|BAM36189.1| cytochrome c oxidase subunit 2 (mitochondrion) [Raphanus sativus] gi|400278309|dbj|BAM36232.1| cytochrome c oxidase subunit 2 (mitochondrion) [Raphanus sativus] Length = 260 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWV NQLIPQT Sbjct: 213 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 257 >gb|AAB88906.1| cytochrome c oxidase subunit II [Brassica rapa subsp. oleifera] Length = 260 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWV NQLIPQT Sbjct: 213 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 257 >dbj|BAD83476.2| cytochrome oxidase subunit 2 (mitochondrion) [Nicotiana tabacum] Length = 260 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWV NQLIPQT Sbjct: 213 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 257 >ref|NP_064061.2| cox2 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435041|ref|YP_004222256.1| cytochrome c oxidase subunit 2 [Beta vulgaris subsp. maritima] gi|346683134|ref|YP_004842063.1| cytochrome c oxidase subunit 2 [Beta macrocarpa] gi|87248025|gb|ABD36067.1| cytochrome oxidase subunit 2 [Beta vulgaris subsp. vulgaris] gi|148491430|dbj|BAA99453.2| cytochrome c oxidase subunit 2 [Beta vulgaris subsp. vulgaris] gi|317905694|emb|CBJ14086.1| cytochrome c oxidase subunit 2 [Beta vulgaris subsp. maritima] gi|319439774|emb|CBJ17495.1| cytochrome c oxidase subunit 2 [Beta vulgaris subsp. maritima] gi|345500052|emb|CBX24868.1| cytochrome c oxidase subunit 2 [Beta macrocarpa] gi|384939216|emb|CBL52062.2| cytochrome c oxidase subunit 2 (mitochondrion) [Beta vulgaris subsp. maritima] Length = 260 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWV NQLIPQT Sbjct: 213 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIPQT 257 >ref|YP_006460161.1| cytochrome c oxidase subunit II (mitochondrion) [Mimulus guttatus] gi|340007652|gb|AEK26516.1| cytochrome c oxidase subunit 2 (mitochondrion) [Mimulus guttatus] Length = 260 Score = 95.5 bits (236), Expect = 6e-18 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFMPIVVEAV RKDYGSWV NQLIPQT Sbjct: 213 QREGVYYGQCSEICGTNHAFMPIVVEAVPRKDYGSWVSNQLIPQT 257 >ref|YP_005090445.1| cytochrome c oxidase subunit 2, partial (mitochondrion) [Millettia pinnata] gi|370288191|gb|AET62905.2| cytochrome c oxidase subunit 2, partial (mitochondrion) [Millettia pinnata] Length = 260 Score = 95.1 bits (235), Expect = 8e-18 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFMPIVVEAVS KDYGSWV NQLIPQT Sbjct: 212 QREGVYYGQCSEICGTNHAFMPIVVEAVSSKDYGSWVSNQLIPQT 256 >ref|YP_003875498.1| cytochrome c oxidase subunit 2 [Silene latifolia] gi|296040639|gb|ADG85287.1| cytochrome c oxidase subunit 2 [Silene latifolia] gi|301338025|gb|ADK73317.1| cytochrome c oxidase subunit 2 [Silene latifolia] Length = 259 Score = 95.1 bits (235), Expect = 8e-18 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWV QLIPQT Sbjct: 212 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSTQLIPQT 256 >ref|YP_717172.1| cytochrome c oxidase subunit 2 [Brassica napus] gi|37591120|dbj|BAC98922.1| cytochrome c oxidase subunit 2 [Brassica napus] Length = 260 Score = 94.4 bits (233), Expect = 1e-17 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFM IVVEAVSRKDYGSWV NQLIPQT Sbjct: 213 QREGVYYGQCSEICGTNHAFMSIVVEAVSRKDYGSWVSNQLIPQT 257 >sp|P93285.2|COX2_ARATH RecName: Full=Cytochrome c oxidase subunit 2; AltName: Full=Cytochrome c oxidase polypeptide II Length = 260 Score = 94.4 bits (233), Expect = 1e-17 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFM IVVEAVSRKDYGSWV NQLIPQT Sbjct: 213 QREGVYYGQCSEICGTNHAFMSIVVEAVSRKDYGSWVSNQLIPQT 257 >gb|AHA84973.1| cytochrome c oxidase subunit 2 (mitochondrion) [Ajuga reptans] Length = 255 Score = 93.6 bits (231), Expect = 2e-17 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIP 207 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWV NQLIP Sbjct: 213 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVSNQLIP 255 >gb|ABB43241.1| cytochrome c oxidase subunit II [Solanum tuberosum] Length = 258 Score = 93.6 bits (231), Expect = 2e-17 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKD GSWV NQLIPQT Sbjct: 213 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDDGSWVSNQLIPQT 257 >ref|YP_005090502.1| cytochrome c oxidase subunit 2 (mitochondrion) [Lotus japonicus] gi|357197366|gb|AET62962.1| cytochrome c oxidase subunit 2 (mitochondrion) [Lotus japonicus] Length = 257 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQ 204 QREGVYYGQCSEICGTNHAFMPIVVEAVS KDYGSWV NQLIPQ Sbjct: 212 QREGVYYGQCSEICGTNHAFMPIVVEAVSSKDYGSWVSNQLIPQ 255 >sp|P98012.1|COX2_BETVU RecName: Full=Cytochrome c oxidase subunit 2; AltName: Full=Cytochrome c oxidase polypeptide II gi|11261|emb|CAA39009.1| cytochrome oxidase subunit II [Beta vulgaris subsp. vulgaris] Length = 260 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGS V NQLIPQT Sbjct: 213 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSRVSNQLIPQT 257 >dbj|BAD66739.1| cytochrome oxidase subunit 2 [Beta vulgaris subsp. vulgaris] Length = 263 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGS V NQLIPQT Sbjct: 216 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSRVSNQLIPQT 260 >emb|CAA40875.1| NcoxII [Beta vulgaris subsp. vulgaris] gi|11269|emb|CAA40876.1| ScoxII [Beta vulgaris subsp. vulgaris] Length = 260 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGS V NQLIPQT Sbjct: 213 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSRVSNQLIPQT 257 >ref|YP_004935320.1| cytochrome c oxidase subunit 2 (mitochondrion) [Silene noctiflora] gi|343527003|gb|AEM46224.1| cytochrome c oxidase subunit 2 (mitochondrion) [Silene noctiflora] Length = 258 Score = 91.7 bits (226), Expect = 9e-17 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFMPIVVEA+SRKDY SWV QLIPQT Sbjct: 214 QREGVYYGQCSEICGTNHAFMPIVVEALSRKDYASWVATQLIPQT 258 >gb|ADG85288.1| cytochrome c oxidase subunit 2 [Silene noctiflora] Length = 258 Score = 91.7 bits (226), Expect = 9e-17 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFMPIVVEA+SRKDY SWV QLIPQT Sbjct: 214 QREGVYYGQCSEICGTNHAFMPIVVEALSRKDYASWVATQLIPQT 258 >ref|XP_002534951.1| cytochrome C oxidase, subunit II, putative [Ricinus communis] gi|223524317|gb|EEF27436.1| cytochrome C oxidase, subunit II, putative [Ricinus communis] Length = 272 Score = 91.3 bits (225), Expect = 1e-16 Identities = 41/45 (91%), Positives = 41/45 (91%) Frame = -2 Query: 335 QREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSWVGNQLIPQT 201 QREGVYYGQCSEICGTNHAFMPIVVEAV KDYG WV NQLIPQT Sbjct: 213 QREGVYYGQCSEICGTNHAFMPIVVEAVPGKDYGDWVSNQLIPQT 257