BLASTX nr result
ID: Jatropha_contig00045161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00045161 (350 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADU56176.1| major allergen Pru ar [Jatropha curcas] 65 7e-09 >gb|ADU56176.1| major allergen Pru ar [Jatropha curcas] Length = 157 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +3 Query: 3 YPKGNAEIDISKIKDAEEKTEGLVKAVEAYLVANPDA 113 YPKGNAEID SKIK+AE+ T+G VKAVEAYLVANPDA Sbjct: 121 YPKGNAEIDPSKIKEAEDMTDGFVKAVEAYLVANPDA 157