BLASTX nr result
ID: Jatropha_contig00045111
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00045111 (367 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512963.1| cysteine protease, putative [Ricinus communi... 97 3e-18 ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a-like [S... 95 8e-18 gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida] 95 8e-18 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trich... 95 1e-17 gb|AAX19661.1| cysteine proteinase [Populus tomentosa] 95 1e-17 ref|XP_002305451.1| predicted protein [Populus trichocarpa] 95 1e-17 sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltNa... 94 1e-17 ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [S... 94 2e-17 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao] 94 2e-17 ref|XP_002313770.1| predicted protein [Populus trichocarpa] gi|2... 94 2e-17 gb|ABK92536.1| unknown [Populus trichocarpa] 94 2e-17 ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula] gi... 94 2e-17 ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula] gi... 94 2e-17 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao] 93 3e-17 gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoaca... 93 3e-17 gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides] 93 4e-17 gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform... 92 5e-17 gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform... 92 5e-17 gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform... 92 5e-17 gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas] 92 5e-17 >ref|XP_002512963.1| cysteine protease, putative [Ricinus communis] gi|223547974|gb|EEF49466.1| cysteine protease, putative [Ricinus communis] Length = 373 Score = 96.7 bits (239), Expect = 3e-18 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSSQ 229 PYWIIKNSWGE WGESGYYKICRGRN+CGVDSMVSTVAAVQT+S+ Sbjct: 329 PYWIIKNSWGENWGESGYYKICRGRNICGVDSMVSTVAAVQTASE 373 >ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a-like [Solanum lycopersicum] Length = 369 Score = 95.1 bits (235), Expect = 8e-18 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS 232 PYWIIKNSWGE WGESGYYKICRGRNVCGVDSMVSTVAAV TSS Sbjct: 325 PYWIIKNSWGEKWGESGYYKICRGRNVCGVDSMVSTVAAVSTSS 368 >gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida] Length = 190 Score = 95.1 bits (235), Expect = 8e-18 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS 232 PYWIIKNSWGE WGESGYYKICRGRNVCGVDSMVSTVAAV TSS Sbjct: 147 PYWIIKNSWGEKWGESGYYKICRGRNVCGVDSMVSTVAAVSTSS 190 >gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa] Length = 368 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSSQ 229 P+WIIKNSWGE WGE+G+YKICRGRNVCGVDSMVSTVAAVQTSSQ Sbjct: 324 PFWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTSSQ 368 >gb|AAX19661.1| cysteine proteinase [Populus tomentosa] Length = 374 Score = 94.7 bits (234), Expect = 1e-17 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS 232 PYWIIKNSWGE+WGE+G+YKICRGRN+CGVDSMVSTVAAVQTSS Sbjct: 330 PYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQTSS 373 >ref|XP_002305451.1| predicted protein [Populus trichocarpa] Length = 368 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSSQ 229 P+WIIKNSWGE WGE+G+YKICRGRNVCGVDSMVSTVAAVQTSSQ Sbjct: 324 PFWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTSSQ 368 >sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13 gi|18086|emb|CAA27609.1| pot. cysteine proteinase [Carica papaya] Length = 96 Score = 94.4 bits (233), Expect = 1e-17 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSSQ 229 PYW+IKNSWGE WGE+GYYKICRGRN+CGVDSMVSTVAAV T+SQ Sbjct: 52 PYWVIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTSQ 96 >ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum] Length = 368 Score = 94.0 bits (232), Expect = 2e-17 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS 232 PYWIIKNSWGE WGE+GYYKICRGRNVCGVDSMVSTVAAV TSS Sbjct: 325 PYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVSTSS 368 >gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao] Length = 401 Score = 93.6 bits (231), Expect = 2e-17 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSSQ 229 PYWIIKNSWGE WGE GYYKICRGRNVCGVDSMVS+VAA+QT SQ Sbjct: 357 PYWIIKNSWGENWGEEGYYKICRGRNVCGVDSMVSSVAALQTKSQ 401 >ref|XP_002313770.1| predicted protein [Populus trichocarpa] gi|222850178|gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa] Length = 368 Score = 93.6 bits (231), Expect = 2e-17 Identities = 39/44 (88%), Positives = 44/44 (100%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS 232 PYWIIKNSWGE+WGE+G+YKICRGRN+CGVDSMVSTVAAVQT+S Sbjct: 324 PYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQTNS 367 >gb|ABK92536.1| unknown [Populus trichocarpa] Length = 368 Score = 93.6 bits (231), Expect = 2e-17 Identities = 39/44 (88%), Positives = 44/44 (100%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS 232 PYWIIKNSWGE+WGE+G+YKICRGRN+CGVDSMVSTVAAVQT+S Sbjct: 324 PYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQTNS 367 >ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula] gi|355508165|gb|AES89307.1| Cysteine proteinase [Medicago truncatula] Length = 331 Score = 93.6 bits (231), Expect = 2e-17 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSSQ 229 PYWI+KNSWGETWGE+GYYKICRGRN+CGVDSMVSTVAA T++Q Sbjct: 287 PYWIVKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAHTTTQ 331 >ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula] gi|355508053|gb|AES89195.1| Cysteine proteinase [Medicago truncatula] Length = 362 Score = 93.6 bits (231), Expect = 2e-17 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS 232 PYWIIKNSWGETWGE+GYYKICRGRN+CGVDSMVSTVAAV T++ Sbjct: 319 PYWIIKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAVHTTT 362 >gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao] Length = 395 Score = 93.2 bits (230), Expect = 3e-17 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSSQ 229 PYWIIKNSWGE+WGE G+YKICRGRN+CGVDSMVSTVAAV T+SQ Sbjct: 351 PYWIIKNSWGESWGEDGFYKICRGRNICGVDSMVSTVAAVDTNSQ 395 >gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia] Length = 335 Score = 93.2 bits (230), Expect = 3e-17 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTS 235 PYWIIKNSWGE+WGE+GYYKICRGRNVCGVDSMVSTVAAV TS Sbjct: 291 PYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVHTS 333 >gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides] Length = 156 Score = 92.8 bits (229), Expect = 4e-17 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS 232 P+WIIKNSWGE WGE+G+YKICRGRNVCGVDSMVSTVAAVQTSS Sbjct: 113 PFWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTSS 156 >gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas] Length = 366 Score = 92.4 bits (228), Expect = 5e-17 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS 232 PYWIIKNSWGE+WGE+GYYKICRGRNVCGVDSMVSTVAAV T++ Sbjct: 321 PYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTT 364 >gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas] Length = 368 Score = 92.4 bits (228), Expect = 5e-17 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS 232 PYWIIKNSWGE+WGE+GYYKICRGRNVCGVDSMVSTVAAV T++ Sbjct: 323 PYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTT 366 >gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas] Length = 368 Score = 92.4 bits (228), Expect = 5e-17 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS 232 PYWIIKNSWGE+WGE+GYYKICRGRNVCGVDSMVSTVAAV T++ Sbjct: 323 PYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTT 366 >gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas] Length = 366 Score = 92.4 bits (228), Expect = 5e-17 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 363 PYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS 232 PYWIIKNSWGE+WGE+GYYKICRGRNVCGVDSMVSTVAAV T++ Sbjct: 321 PYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTT 364