BLASTX nr result
ID: Jatropha_contig00045051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00045051 (366 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525028.1| conserved hypothetical protein [Ricinus comm... 72 7e-11 ref|XP_002308741.1| predicted protein [Populus trichocarpa] 67 2e-09 gb|EOX92933.1| Uncharacterized protein TCM_001795 [Theobroma cacao] 66 4e-09 ref|XP_002525029.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_003635480.1| PREDICTED: uncharacterized protein LOC100853... 58 1e-06 >ref|XP_002525028.1| conserved hypothetical protein [Ricinus communis] gi|223535690|gb|EEF37355.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 72.0 bits (175), Expect = 7e-11 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -2 Query: 266 PRLRASEDVVHPQ-GCRCCFFVGRVPNLRCGKVCCGDDCC 150 PRL+ SE +V PQ GCRCCFF+GR+PN+RCG VCC D CC Sbjct: 30 PRLQTSEHMVQPQAGCRCCFFIGRIPNIRCGNVCCEDGCC 69 >ref|XP_002308741.1| predicted protein [Populus trichocarpa] Length = 75 Score = 67.0 bits (162), Expect = 2e-09 Identities = 26/43 (60%), Positives = 33/43 (76%), Gaps = 4/43 (9%) Frame = -2 Query: 266 PRLRASEDVVHPQGCRCCFFVGRVPNLRCGKVCC----GDDCC 150 PRL A+E V +PQGCRCC FVG+VPN+RC + CC G++CC Sbjct: 30 PRLLATEQVYYPQGCRCCLFVGKVPNIRCARTCCSSPKGENCC 72 >gb|EOX92933.1| Uncharacterized protein TCM_001795 [Theobroma cacao] Length = 69 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 263 RLRASEDVVHPQGCRCCFFVGRVPNLRCGKVCCGDDCC 150 RL + E HPQGCRCCFF+ + P +RCGKVCCGDDCC Sbjct: 32 RLESFEQGFHPQGCRCCFFIWK-PMIRCGKVCCGDDCC 68 >ref|XP_002525029.1| conserved hypothetical protein [Ricinus communis] gi|223535691|gb|EEF37356.1| conserved hypothetical protein [Ricinus communis] Length = 70 Score = 62.4 bits (150), Expect = 6e-08 Identities = 23/40 (57%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = -2 Query: 266 PRLRASEDVVH-PQGCRCCFFVGRVPNLRCGKVCCGDDCC 150 PRL+AS++ + P GCRCC+F+G++P +RCG VCC D CC Sbjct: 30 PRLQASDEHMELPAGCRCCYFIGQIPYMRCGMVCCQDGCC 69 >ref|XP_003635480.1| PREDICTED: uncharacterized protein LOC100853147 [Vitis vinifera] gi|296090665|emb|CBI41065.3| unnamed protein product [Vitis vinifera] Length = 68 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Frame = -2 Query: 257 RASEDVVHPQ-GCRCCFFVGRVPNLRCGKVCCGDDCC 150 +A ED+VHPQ GCRCC+F+ + P + CGK CCGD CC Sbjct: 30 QAVEDMVHPQAGCRCCWFIWK-PRISCGKACCGDGCC 65