BLASTX nr result
ID: Jatropha_contig00044869
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00044869 (255 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521877.1| zinc finger protein, putative [Ricinus commu... 64 2e-08 emb|CAN61246.1| hypothetical protein VITISV_014803 [Vitis vinifera] 63 4e-08 ref|XP_002273614.1| PREDICTED: uncharacterized protein LOC100257... 61 2e-07 gb|EOY01203.1| Indeterminate(ID)-domain 5, putative isoform 6 [T... 59 8e-07 gb|EOY01199.1| Indeterminate(ID)-domain 5, putative isoform 2 [T... 59 8e-07 gb|EOY01198.1| Indeterminate(ID)-domain 5, putative isoform 1 [T... 59 8e-07 gb|AEK28686.1| zinc finger C2H2 type family protein [Populus tre... 57 3e-06 gb|ADC67979.1| hypothetical protein POPTRDRAFT_566362 [Populus b... 57 3e-06 gb|ADC67960.1| hypothetical protein POPTRDRAFT_566362 [Populus b... 57 3e-06 gb|ADC67944.1| hypothetical protein POPTRDRAFT_566362 [Populus b... 57 3e-06 gb|ADC67934.1| hypothetical protein POPTRDRAFT_566362 [Populus b... 57 3e-06 gb|ADC67932.1| hypothetical protein POPTRDRAFT_566362 [Populus b... 57 3e-06 gb|ADC67926.1| hypothetical protein POPTRDRAFT_566362 [Populus b... 57 3e-06 gb|ADC67916.1| hypothetical protein POPTRDRAFT_566362 [Populus b... 57 3e-06 gb|ADC67912.1| hypothetical protein POPTRDRAFT_566362 [Populus b... 57 3e-06 gb|ADC67911.1| hypothetical protein POPTRDRAFT_566362 [Populus b... 57 3e-06 gb|ADC67910.1| hypothetical protein POPTRDRAFT_566362 [Populus b... 57 3e-06 gb|ADC67907.1| hypothetical protein POPTRDRAFT_566362 [Populus b... 57 3e-06 gb|ADC67905.1| hypothetical protein POPTRDRAFT_566362 [Populus b... 57 3e-06 gb|ADC67890.1| hypothetical protein POPTRDRAFT_566362 [Populus b... 57 3e-06 >ref|XP_002521877.1| zinc finger protein, putative [Ricinus communis] gi|223538915|gb|EEF40513.1| zinc finger protein, putative [Ricinus communis] Length = 571 Score = 63.9 bits (154), Expect = 2e-08 Identities = 35/41 (85%), Positives = 35/41 (85%) Frame = +1 Query: 64 MDDHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 M D V S GI SLYSNSMQQENITPHMSATALLQKAAQMG Sbjct: 380 MGDPVGS--GIPSLYSNSMQQENITPHMSATALLQKAAQMG 418 >emb|CAN61246.1| hypothetical protein VITISV_014803 [Vitis vinifera] Length = 306 Score = 62.8 bits (151), Expect = 4e-08 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = +1 Query: 64 MDDHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 M DHV S G+ SLYS SMQQEN+ PHMSATALLQKAAQMG Sbjct: 101 MSDHVGS--GLSSLYSTSMQQENLAPHMSATALLQKAAQMG 139 >ref|XP_002273614.1| PREDICTED: uncharacterized protein LOC100257993 [Vitis vinifera] Length = 587 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +1 Query: 64 MDDHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 M DHV S G+ SLYS SMQQE++ PHMSATALLQKAAQMG Sbjct: 382 MSDHVGS--GLSSLYSTSMQQESLAPHMSATALLQKAAQMG 420 >gb|EOY01203.1| Indeterminate(ID)-domain 5, putative isoform 6 [Theobroma cacao] Length = 578 Score = 58.5 bits (140), Expect = 8e-07 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +1 Query: 64 MDDHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 M D V S G+ SLYS SMQ ENI+PHMSATALLQKAAQMG Sbjct: 369 MGDQVGS--GLSSLYSTSMQHENISPHMSATALLQKAAQMG 407 >gb|EOY01199.1| Indeterminate(ID)-domain 5, putative isoform 2 [Theobroma cacao] gi|508709303|gb|EOY01200.1| Indeterminate(ID)-domain 5, putative isoform 2 [Theobroma cacao] gi|508709304|gb|EOY01201.1| Indeterminate(ID)-domain 5, putative isoform 2 [Theobroma cacao] gi|508709305|gb|EOY01202.1| Indeterminate(ID)-domain 5, putative isoform 2 [Theobroma cacao] Length = 594 Score = 58.5 bits (140), Expect = 8e-07 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +1 Query: 64 MDDHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 M D V S G+ SLYS SMQ ENI+PHMSATALLQKAAQMG Sbjct: 385 MGDQVGS--GLSSLYSTSMQHENISPHMSATALLQKAAQMG 423 >gb|EOY01198.1| Indeterminate(ID)-domain 5, putative isoform 1 [Theobroma cacao] Length = 620 Score = 58.5 bits (140), Expect = 8e-07 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +1 Query: 64 MDDHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 M D V S G+ SLYS SMQ ENI+PHMSATALLQKAAQMG Sbjct: 411 MGDQVGS--GLSSLYSTSMQHENISPHMSATALLQKAAQMG 449 >gb|AEK28686.1| zinc finger C2H2 type family protein [Populus tremula] Length = 193 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 70 DHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 DHV S + SL++ SMQQENITPH+SATALLQKAAQMG Sbjct: 26 DHVGSA--MSSLFNTSMQQENITPHVSATALLQKAAQMG 62 >gb|ADC67979.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] Length = 171 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 70 DHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 DHV S + SL++ SMQQENITPH+SATALLQKAAQMG Sbjct: 16 DHVGSA--MSSLFNTSMQQENITPHVSATALLQKAAQMG 52 >gb|ADC67960.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902773|gb|ADC67972.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] Length = 171 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 70 DHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 DHV S + SL++ SMQQENITPH+SATALLQKAAQMG Sbjct: 16 DHVGSA--MSSLFNTSMQQENITPHVSATALLQKAAQMG 52 >gb|ADC67944.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] Length = 169 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 70 DHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 DHV S + SL++ SMQQENITPH+SATALLQKAAQMG Sbjct: 14 DHVGSA--MSSLFNTSMQQENITPHVSATALLQKAAQMG 50 >gb|ADC67934.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] Length = 170 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 70 DHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 DHV S + SL++ SMQQENITPH+SATALLQKAAQMG Sbjct: 15 DHVGSA--MSSLFNTSMQQENITPHVSATALLQKAAQMG 51 >gb|ADC67932.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] Length = 169 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 70 DHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 DHV S + SL++ SMQQENITPH+SATALLQKAAQMG Sbjct: 14 DHVGSA--MSSLFNTSMQQENITPHVSATALLQKAAQMG 50 >gb|ADC67926.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902713|gb|ADC67942.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902759|gb|ADC67965.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] Length = 171 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 70 DHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 DHV S + SL++ SMQQENITPH+SATALLQKAAQMG Sbjct: 16 DHVGSA--MSSLFNTSMQQENITPHVSATALLQKAAQMG 52 >gb|ADC67916.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902753|gb|ADC67962.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902755|gb|ADC67963.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902785|gb|ADC67978.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] Length = 171 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 70 DHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 DHV S + SL++ SMQQENITPH+SATALLQKAAQMG Sbjct: 16 DHVGSA--MSSLFNTSMQQENITPHVSATALLQKAAQMG 52 >gb|ADC67912.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902655|gb|ADC67913.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902657|gb|ADC67914.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902709|gb|ADC67940.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] Length = 171 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 70 DHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 DHV S + SL++ SMQQENITPH+SATALLQKAAQMG Sbjct: 16 DHVGSA--MSSLFNTSMQQENITPHVSATALLQKAAQMG 52 >gb|ADC67911.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902659|gb|ADC67915.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902707|gb|ADC67939.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] Length = 171 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 70 DHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 DHV S + SL++ SMQQENITPH+SATALLQKAAQMG Sbjct: 16 DHVGSA--MSSLFNTSMQQENITPHVSATALLQKAAQMG 52 >gb|ADC67910.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] Length = 171 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 70 DHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 DHV S + SL++ SMQQENITPH+SATALLQKAAQMG Sbjct: 16 DHVGSA--MSSLFNTSMQQENITPHVSATALLQKAAQMG 52 >gb|ADC67907.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902647|gb|ADC67909.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902699|gb|ADC67935.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902701|gb|ADC67936.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902715|gb|ADC67943.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] Length = 170 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 70 DHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 DHV S + SL++ SMQQENITPH+SATALLQKAAQMG Sbjct: 15 DHVGSA--MSSLFNTSMQQENITPHVSATALLQKAAQMG 51 >gb|ADC67905.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902645|gb|ADC67908.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902731|gb|ADC67951.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902733|gb|ADC67952.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] Length = 171 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 70 DHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 DHV S + SL++ SMQQENITPH+SATALLQKAAQMG Sbjct: 16 DHVGSA--MSSLFNTSMQQENITPHVSATALLQKAAQMG 52 >gb|ADC67890.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902615|gb|ADC67893.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902617|gb|ADC67894.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902621|gb|ADC67896.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902623|gb|ADC67897.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902625|gb|ADC67898.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902637|gb|ADC67904.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902679|gb|ADC67925.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902685|gb|ADC67928.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902691|gb|ADC67931.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902695|gb|ADC67933.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902711|gb|ADC67941.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902721|gb|ADC67946.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902723|gb|ADC67947.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902729|gb|ADC67950.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902735|gb|ADC67953.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902737|gb|ADC67954.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902739|gb|ADC67955.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902741|gb|ADC67956.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902745|gb|ADC67958.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902757|gb|ADC67964.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902765|gb|ADC67968.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902767|gb|ADC67969.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902771|gb|ADC67971.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902775|gb|ADC67973.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] gi|288902783|gb|ADC67977.1| hypothetical protein POPTRDRAFT_566362 [Populus balsamifera] Length = 171 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 70 DHVSSTAGIHSLYSNSMQQENITPHMSATALLQKAAQMG 186 DHV S + SL++ SMQQENITPH+SATALLQKAAQMG Sbjct: 16 DHVGSA--MSSLFNTSMQQENITPHVSATALLQKAAQMG 52