BLASTX nr result
ID: Jatropha_contig00044859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00044859 (927 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514028.1| conserved hypothetical protein [Ricinus comm... 57 7e-06 >ref|XP_002514028.1| conserved hypothetical protein [Ricinus communis] gi|223547114|gb|EEF48611.1| conserved hypothetical protein [Ricinus communis] Length = 1060 Score = 57.4 bits (137), Expect = 7e-06 Identities = 35/82 (42%), Positives = 51/82 (62%), Gaps = 2/82 (2%) Frame = +2 Query: 11 RPDGHSSNMN--TWAVAQCEWNNLLLDVENKDSDPFFPCDTSKQFTTLGNDPSCRETDSA 184 +PD S+M TW E ++ ++D+E K D F CDT K+ LG+ SCRE +SA Sbjct: 980 QPDCADSSMEDGTWDRLPRE-SSRVVDLEVKGGDTFSCCDTGKECRKLGSSGSCREANSA 1038 Query: 185 KLGKANPVESGASFKRS*AERT 250 K+G N V+SG +F+RS ++RT Sbjct: 1039 KVG-VNSVKSGVTFRRSMSQRT 1059