BLASTX nr result
ID: Jatropha_contig00044822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00044822 (167 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB33421.1| putative senescence-associated protein [Pisum sa... 99 4e-19 ref|XP_003614396.1| hypothetical protein MTR_5g051150 [Medicago ... 60 1e-18 ref|XP_003614383.1| hypothetical protein MTR_5g051000 [Medicago ... 60 1e-18 ref|XP_003614394.1| hypothetical protein MTR_5g051130 [Medicago ... 60 1e-18 ref|XP_003614382.1| hypothetical protein MTR_5g050970 [Medicago ... 60 1e-18 ref|XP_003614386.1| hypothetical protein MTR_5g051030 [Medicago ... 60 1e-18 ref|XP_003614381.1| hypothetical protein MTR_5g050960 [Medicago ... 60 1e-18 ref|XP_003614399.1| hypothetical protein MTR_5g051180 [Medicago ... 60 1e-18 gb|AFK36365.1| unknown [Lotus japonicus] 60 1e-18 gb|ACJ85262.1| unknown [Medicago truncatula] gi|388499474|gb|AFK... 60 1e-18 ref|XP_003614395.1| hypothetical protein MTR_5g051140 [Medicago ... 59 3e-18 ref|XP_003614384.1| hypothetical protein MTR_5g051010 [Medicago ... 59 3e-18 ref|XP_003614388.1| hypothetical protein MTR_5g051050, partial [... 59 3e-18 ref|XP_003541219.1| PREDICTED: uncharacterized protein LOC100796... 60 3e-18 ref|XP_003541206.1| PREDICTED: uncharacterized protein LOC100788... 60 3e-18 ref|XP_003541217.1| PREDICTED: uncharacterized protein LOC100795... 60 3e-18 ref|XP_003542256.1| PREDICTED: uncharacterized protein LOC100793... 60 3e-18 ref|XP_003541205.1| PREDICTED: uncharacterized protein LOC100787... 60 3e-18 ref|XP_003542281.1| PREDICTED: uncharacterized protein LOC100808... 60 3e-18 ref|XP_003581197.1| PREDICTED: uncharacterized protein LOC100822... 60 3e-18 >dbj|BAB33421.1| putative senescence-associated protein [Pisum sativum] Length = 282 Score = 99.4 bits (246), Expect = 4e-19 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -2 Query: 166 LEIRIKRAFTLLFHTRFLFSLSSS*DTERYLLTDVPPQPNSPPDNVFRPDRPPK 5 LEIRIKRAFTLLFHTRFLFSLSSS RYLLTDVPPQPNSPPDNVFRPDRP K Sbjct: 145 LEIRIKRAFTLLFHTRFLFSLSSSLGHLRYLLTDVPPQPNSPPDNVFRPDRPTK 198 >ref|XP_003614396.1| hypothetical protein MTR_5g051150 [Medicago truncatula] gi|355515731|gb|AES97354.1| hypothetical protein MTR_5g051150 [Medicago truncatula] Length = 2133 Score = 59.7 bits (143), Expect(2) = 1e-18 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELILGH Sbjct: 1491 TGNQNQTSFYPFVPHEISVLVELILGH 1517 Score = 58.9 bits (141), Expect(2) = 1e-18 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRPPK 5 RYLLTDVPPQPNSPPDNVFRPDRP K Sbjct: 1519 RYLLTDVPPQPNSPPDNVFRPDRPTK 1544 Score = 58.9 bits (141), Expect(2) = 3e-18 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRPPK 5 RYLLTDVPPQPNSPPDNVFRPDRP K Sbjct: 568 RYLLTDVPPQPNSPPDNVFRPDRPTK 593 Score = 58.2 bits (139), Expect(2) = 3e-18 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLV+LILGH Sbjct: 540 TGNQNQTSFYPFVPHEISVLVKLILGH 566 >ref|XP_003614383.1| hypothetical protein MTR_5g051000 [Medicago truncatula] gi|355515718|gb|AES97341.1| hypothetical protein MTR_5g051000 [Medicago truncatula] Length = 1735 Score = 59.7 bits (143), Expect(2) = 1e-18 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELILGH Sbjct: 693 TGNQNQTSFYPFVPHEISVLVELILGH 719 Score = 58.9 bits (141), Expect(2) = 1e-18 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRPPK 5 RYLLTDVPPQPNSPPDNVFRPDRP K Sbjct: 721 RYLLTDVPPQPNSPPDNVFRPDRPTK 746 >ref|XP_003614394.1| hypothetical protein MTR_5g051130 [Medicago truncatula] gi|355515729|gb|AES97352.1| hypothetical protein MTR_5g051130 [Medicago truncatula] Length = 1337 Score = 59.7 bits (143), Expect(2) = 1e-18 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELILGH Sbjct: 90 TGNQNQTSFYPFVPHEISVLVELILGH 116 Score = 58.9 bits (141), Expect(2) = 1e-18 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRPPK 5 RYLLTDVPPQPNSPPDNVFRPDRP K Sbjct: 118 RYLLTDVPPQPNSPPDNVFRPDRPTK 143 >ref|XP_003614382.1| hypothetical protein MTR_5g050970 [Medicago truncatula] gi|355515717|gb|AES97340.1| hypothetical protein MTR_5g050970 [Medicago truncatula] Length = 1065 Score = 59.7 bits (143), Expect(2) = 1e-18 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELILGH Sbjct: 184 TGNQNQTSFYPFVPHEISVLVELILGH 210 Score = 58.9 bits (141), Expect(2) = 1e-18 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRPPK 5 RYLLTDVPPQPNSPPDNVFRPDRP K Sbjct: 212 RYLLTDVPPQPNSPPDNVFRPDRPTK 237 >ref|XP_003614386.1| hypothetical protein MTR_5g051030 [Medicago truncatula] gi|355515721|gb|AES97344.1| hypothetical protein MTR_5g051030 [Medicago truncatula] Length = 795 Score = 59.7 bits (143), Expect(2) = 1e-18 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELILGH Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGH 81 Score = 58.9 bits (141), Expect(2) = 1e-18 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRPPK 5 RYLLTDVPPQPNSPPDNVFRPDRP K Sbjct: 83 RYLLTDVPPQPNSPPDNVFRPDRPTK 108 >ref|XP_003614381.1| hypothetical protein MTR_5g050960 [Medicago truncatula] gi|355515716|gb|AES97339.1| hypothetical protein MTR_5g050960 [Medicago truncatula] Length = 394 Score = 59.7 bits (143), Expect(2) = 1e-18 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELILGH Sbjct: 135 TGNQNQTSFYPFVPHEISVLVELILGH 161 Score = 58.9 bits (141), Expect(2) = 1e-18 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRPPK 5 RYLLTDVPPQPNSPPDNVFRPDRP K Sbjct: 163 RYLLTDVPPQPNSPPDNVFRPDRPTK 188 >ref|XP_003614399.1| hypothetical protein MTR_5g051180 [Medicago truncatula] gi|355515734|gb|AES97357.1| hypothetical protein MTR_5g051180 [Medicago truncatula] Length = 237 Score = 59.7 bits (143), Expect(2) = 1e-18 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELILGH Sbjct: 135 TGNQNQTSFYPFVPHEISVLVELILGH 161 Score = 58.9 bits (141), Expect(2) = 1e-18 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRPPK 5 RYLLTDVPPQPNSPPDNVFRPDRP K Sbjct: 163 RYLLTDVPPQPNSPPDNVFRPDRPTK 188 >gb|AFK36365.1| unknown [Lotus japonicus] Length = 157 Score = 59.7 bits (143), Expect(2) = 1e-18 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELILGH Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGH 81 Score = 58.9 bits (141), Expect(2) = 1e-18 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRPPK 5 RYLLTDVPPQPNSPPDNVFRPDRP K Sbjct: 83 RYLLTDVPPQPNSPPDNVFRPDRPAK 108 >gb|ACJ85262.1| unknown [Medicago truncatula] gi|388499474|gb|AFK37803.1| unknown [Medicago truncatula] Length = 157 Score = 59.7 bits (143), Expect(2) = 1e-18 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELILGH Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGH 81 Score = 58.9 bits (141), Expect(2) = 1e-18 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRPPK 5 RYLLTDVPPQPNSPPDNVFRPDRP K Sbjct: 83 RYLLTDVPPQPNSPPDNVFRPDRPTK 108 >ref|XP_003614395.1| hypothetical protein MTR_5g051140 [Medicago truncatula] gi|355515730|gb|AES97353.1| hypothetical protein MTR_5g051140 [Medicago truncatula] Length = 1186 Score = 58.9 bits (141), Expect(2) = 3e-18 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRPPK 5 RYLLTDVPPQPNSPPDNVFRPDRP K Sbjct: 118 RYLLTDVPPQPNSPPDNVFRPDRPTK 143 Score = 58.2 bits (139), Expect(2) = 3e-18 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELI GH Sbjct: 90 TGNQNQTSFYPFVPHEISVLVELIFGH 116 >ref|XP_003614384.1| hypothetical protein MTR_5g051010 [Medicago truncatula] gi|355515719|gb|AES97342.1| hypothetical protein MTR_5g051010 [Medicago truncatula] Length = 1153 Score = 58.9 bits (141), Expect(2) = 3e-18 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRPPK 5 RYLLTDVPPQPNSPPDNVFRPDRP K Sbjct: 212 RYLLTDVPPQPNSPPDNVFRPDRPTK 237 Score = 58.2 bits (139), Expect(2) = 3e-18 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELI GH Sbjct: 184 TGNQNQTSFYPFVPHEISVLVELIFGH 210 >ref|XP_003614388.1| hypothetical protein MTR_5g051050, partial [Medicago truncatula] gi|355515723|gb|AES97346.1| hypothetical protein MTR_5g051050, partial [Medicago truncatula] Length = 596 Score = 58.9 bits (141), Expect(2) = 3e-18 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRPPK 5 RYLLTDVPPQPNSPPDNVFRPDRP K Sbjct: 215 RYLLTDVPPQPNSPPDNVFRPDRPTK 240 Score = 58.2 bits (139), Expect(2) = 3e-18 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLV+LILGH Sbjct: 187 TGNQNQTSFYPFVPHEISVLVKLILGH 213 >ref|XP_003541219.1| PREDICTED: uncharacterized protein LOC100796402 [Glycine max] Length = 265 Score = 59.7 bits (143), Expect(2) = 3e-18 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELILGH Sbjct: 163 TGNQNQTSFYPFVPHEISVLVELILGH 189 Score = 57.4 bits (137), Expect(2) = 3e-18 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRP 11 RYLLTDVPPQPNSPPDNVFRPDRP Sbjct: 191 RYLLTDVPPQPNSPPDNVFRPDRP 214 >ref|XP_003541206.1| PREDICTED: uncharacterized protein LOC100788489 [Glycine max] Length = 239 Score = 59.7 bits (143), Expect(2) = 3e-18 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELILGH Sbjct: 137 TGNQNQTSFYPFVPHEISVLVELILGH 163 Score = 57.4 bits (137), Expect(2) = 3e-18 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRP 11 RYLLTDVPPQPNSPPDNVFRPDRP Sbjct: 165 RYLLTDVPPQPNSPPDNVFRPDRP 188 >ref|XP_003541217.1| PREDICTED: uncharacterized protein LOC100795351 [Glycine max] Length = 191 Score = 59.7 bits (143), Expect(2) = 3e-18 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELILGH Sbjct: 89 TGNQNQTSFYPFVPHEISVLVELILGH 115 Score = 57.4 bits (137), Expect(2) = 3e-18 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRP 11 RYLLTDVPPQPNSPPDNVFRPDRP Sbjct: 117 RYLLTDVPPQPNSPPDNVFRPDRP 140 >ref|XP_003542256.1| PREDICTED: uncharacterized protein LOC100793251 [Glycine max] Length = 189 Score = 59.7 bits (143), Expect(2) = 3e-18 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELILGH Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGH 81 Score = 57.4 bits (137), Expect(2) = 3e-18 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRP 11 RYLLTDVPPQPNSPPDNVFRPDRP Sbjct: 83 RYLLTDVPPQPNSPPDNVFRPDRP 106 >ref|XP_003541205.1| PREDICTED: uncharacterized protein LOC100787432, partial [Glycine max] Length = 159 Score = 59.7 bits (143), Expect(2) = 3e-18 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELILGH Sbjct: 57 TGNQNQTSFYPFVPHEISVLVELILGH 83 Score = 57.4 bits (137), Expect(2) = 3e-18 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRP 11 RYLLTDVPPQPNSPPDNVFRPDRP Sbjct: 85 RYLLTDVPPQPNSPPDNVFRPDRP 108 >ref|XP_003542281.1| PREDICTED: uncharacterized protein LOC100808462 [Glycine max] gi|356547770|ref|XP_003542282.1| PREDICTED: uncharacterized protein LOC100808996 [Glycine max] gi|356547773|ref|XP_003542283.1| PREDICTED: uncharacterized protein LOC100810077 [Glycine max] gi|356547775|ref|XP_003542284.1| PREDICTED: uncharacterized protein LOC100810602 [Glycine max] gi|356547826|ref|XP_003542306.1| PREDICTED: uncharacterized protein LOC100809185 [Glycine max] gi|561005735|gb|ESW04729.1| hypothetical protein PHAVU_011G120500g [Phaseolus vulgaris] Length = 157 Score = 59.7 bits (143), Expect(2) = 3e-18 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELILGH Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGH 81 Score = 57.4 bits (137), Expect(2) = 3e-18 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRP 11 RYLLTDVPPQPNSPPDNVFRPDRP Sbjct: 83 RYLLTDVPPQPNSPPDNVFRPDRP 106 >ref|XP_003581197.1| PREDICTED: uncharacterized protein LOC100822817 [Brachypodium distachyon] gi|357167592|ref|XP_003581238.1| PREDICTED: uncharacterized protein LOC100839787 [Brachypodium distachyon] gi|357167653|ref|XP_003581268.1| PREDICTED: uncharacterized protein LOC100827645 [Brachypodium distachyon] Length = 127 Score = 59.7 bits (143), Expect(2) = 3e-18 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 167 TGNQNQTSFYPFVPHEISVLVELILGH 87 TGNQNQTSFYPFVPHEISVLVELILGH Sbjct: 55 TGNQNQTSFYPFVPHEISVLVELILGH 81 Score = 57.4 bits (137), Expect(2) = 3e-18 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 82 RYLLTDVPPQPNSPPDNVFRPDRP 11 RYLLTDVPPQPNSPPDNVFRPDRP Sbjct: 83 RYLLTDVPPQPNSPPDNVFRPDRP 106