BLASTX nr result
ID: Jatropha_contig00044717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00044717 (330 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP46989.1| hypothetical protein POPTR_0365s00230g [Populus t... 81 2e-13 ref|XP_002276744.2| PREDICTED: uncharacterized transporter YBR28... 79 4e-13 emb|CAN62432.1| hypothetical protein VITISV_012649 [Vitis vinifera] 79 4e-13 gb|ERP60778.1| hypothetical protein POPTR_0005s10230g [Populus t... 79 6e-13 gb|ERP60777.1| hypothetical protein POPTR_0005s10230g [Populus t... 79 6e-13 gb|EEE93417.2| auxin efflux carrier family protein [Populus tric... 79 6e-13 gb|ERP60773.1| hypothetical protein POPTR_0005s10230g [Populus t... 79 6e-13 ref|XP_002306421.1| predicted protein [Populus trichocarpa] 79 6e-13 gb|EOX90623.1| Auxin efflux carrier family protein isoform 2 [Th... 78 1e-12 gb|EOX90622.1| Auxin efflux carrier family protein isoform 1 [Th... 78 1e-12 ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus ... 77 2e-12 ref|XP_006343325.1| PREDICTED: uncharacterized transporter YBR28... 75 8e-12 gb|ESR38494.1| hypothetical protein CICLE_v10025741mg [Citrus cl... 74 2e-11 gb|ESR38493.1| hypothetical protein CICLE_v10025741mg [Citrus cl... 74 2e-11 ref|XP_004234507.1| PREDICTED: uncharacterized transporter YBR28... 74 2e-11 gb|ADM76841.1| auxin efflux carrier-like protein, partial [Picea... 73 3e-11 gb|ADM76812.1| auxin efflux carrier-like protein, partial [Picea... 73 3e-11 gb|ADM76808.1| auxin efflux carrier-like protein, partial [Picea... 73 3e-11 ref|XP_002461853.1| hypothetical protein SORBIDRAFT_02g009270 [S... 73 3e-11 ref|XP_004159743.1| PREDICTED: uncharacterized transporter YBR28... 72 5e-11 >gb|ERP46989.1| hypothetical protein POPTR_0365s00230g [Populus trichocarpa] Length = 428 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWILS 211 TMTQLFNVGQEECSVLFLWTYL AALALT WST+FMWILS Sbjct: 389 TMTQLFNVGQEECSVLFLWTYLVAALALTAWSTIFMWILS 428 >ref|XP_002276744.2| PREDICTED: uncharacterized transporter YBR287W-like [Vitis vinifera] gi|296082565|emb|CBI21570.3| unnamed protein product [Vitis vinifera] Length = 421 Score = 79.3 bits (194), Expect = 4e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWILS 211 TMT+LFNVGQEECSVLFLWTYL AALALTVWST++MW+LS Sbjct: 382 TMTELFNVGQEECSVLFLWTYLFAALALTVWSTIYMWLLS 421 >emb|CAN62432.1| hypothetical protein VITISV_012649 [Vitis vinifera] Length = 436 Score = 79.3 bits (194), Expect = 4e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWILS 211 TMT+LFNVGQEECSVLFLWTYL AALALTVWST++MW+LS Sbjct: 397 TMTELFNVGQEECSVLFLWTYLFAALALTVWSTIYMWLLS 436 >gb|ERP60778.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 370 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWILS 211 TMTQLF+VGQEECSVLFLWTYL AALALT WST+FMWILS Sbjct: 331 TMTQLFDVGQEECSVLFLWTYLVAALALTAWSTIFMWILS 370 >gb|ERP60777.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 266 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWILS 211 TMTQLF+VGQEECSVLFLWTYL AALALT WST+FMWILS Sbjct: 227 TMTQLFDVGQEECSVLFLWTYLVAALALTAWSTIFMWILS 266 >gb|EEE93417.2| auxin efflux carrier family protein [Populus trichocarpa] gi|550338532|gb|ERP60774.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338533|gb|ERP60775.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338534|gb|ERP60776.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 418 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWILS 211 TMTQLF+VGQEECSVLFLWTYL AALALT WST+FMWILS Sbjct: 379 TMTQLFDVGQEECSVLFLWTYLVAALALTAWSTIFMWILS 418 >gb|ERP60773.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338537|gb|ERP60779.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 344 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWILS 211 TMTQLF+VGQEECSVLFLWTYL AALALT WST+FMWILS Sbjct: 305 TMTQLFDVGQEECSVLFLWTYLVAALALTAWSTIFMWILS 344 >ref|XP_002306421.1| predicted protein [Populus trichocarpa] Length = 397 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWILS 211 TMTQLF+VGQEECSVLFLWTYL AALALT WST+FMWILS Sbjct: 358 TMTQLFDVGQEECSVLFLWTYLVAALALTAWSTIFMWILS 397 >gb|EOX90623.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao] Length = 421 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWILS 211 TMTQLF+VGQEECSVLFLWTYL A LALT WSTVFMWIL+ Sbjct: 382 TMTQLFDVGQEECSVLFLWTYLAAGLALTTWSTVFMWILT 421 >gb|EOX90622.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao] Length = 420 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWILS 211 TMTQLF+VGQEECSVLFLWTYL A LALT WSTVFMWIL+ Sbjct: 381 TMTQLFDVGQEECSVLFLWTYLAAGLALTTWSTVFMWILT 420 >ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223539130|gb|EEF40726.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 406 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWILS 211 TMTQLF+VGQEECSVLFLWTYL AALALT WST++MWILS Sbjct: 367 TMTQLFDVGQEECSVLFLWTYLVAALALTFWSTIYMWILS 406 >ref|XP_006343325.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum tuberosum] Length = 395 Score = 75.1 bits (183), Expect = 8e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWIL 214 TMTQLF+V QEECSVLFLWTYL AA ALT+WST+FMW+L Sbjct: 356 TMTQLFDVAQEECSVLFLWTYLAAAFALTIWSTIFMWLL 394 >gb|ESR38494.1| hypothetical protein CICLE_v10025741mg [Citrus clementina] Length = 299 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWILS 211 TMTQLF+V QEECSVLFLWTYL AALALT WS VFMWILS Sbjct: 260 TMTQLFDVAQEECSVLFLWTYLVAALALTGWSMVFMWILS 299 >gb|ESR38493.1| hypothetical protein CICLE_v10025741mg [Citrus clementina] Length = 407 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWILS 211 TMTQLF+V QEECSVLFLWTYL AALALT WS VFMWILS Sbjct: 368 TMTQLFDVAQEECSVLFLWTYLVAALALTGWSMVFMWILS 407 >ref|XP_004234507.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum lycopersicum] Length = 388 Score = 73.6 bits (179), Expect = 2e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWIL 214 TMTQLF+V QEECSVLFLWTYL A ALT+WST+FMW+L Sbjct: 349 TMTQLFDVAQEECSVLFLWTYLAAVFALTIWSTIFMWLL 387 >gb|ADM76841.1| auxin efflux carrier-like protein, partial [Picea sitchensis] Length = 193 Score = 73.2 bits (178), Expect = 3e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWIL 214 TM QLFNVGQ+ECSVLFLWTYL AA+A+T WSTV+MWIL Sbjct: 153 TMAQLFNVGQQECSVLFLWTYLLAAIAITFWSTVYMWIL 191 >gb|ADM76812.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015519|gb|ADM76813.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015549|gb|ADM76828.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015561|gb|ADM76834.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015563|gb|ADM76835.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015565|gb|ADM76836.1| auxin efflux carrier-like protein, partial [Picea sitchensis] Length = 193 Score = 73.2 bits (178), Expect = 3e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWIL 214 TM QLFNVGQ+ECSVLFLWTYL AA+A+T WSTV+MWIL Sbjct: 153 TMAQLFNVGQQECSVLFLWTYLLAAIAITFWSTVYMWIL 191 >gb|ADM76808.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015511|gb|ADM76809.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015513|gb|ADM76810.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015515|gb|ADM76811.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015521|gb|ADM76814.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015523|gb|ADM76815.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015525|gb|ADM76816.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015527|gb|ADM76817.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015529|gb|ADM76818.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015531|gb|ADM76819.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015533|gb|ADM76820.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015535|gb|ADM76821.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015537|gb|ADM76822.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015539|gb|ADM76823.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015541|gb|ADM76824.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015543|gb|ADM76825.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015545|gb|ADM76826.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015547|gb|ADM76827.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015551|gb|ADM76829.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015553|gb|ADM76830.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015555|gb|ADM76831.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015557|gb|ADM76832.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015559|gb|ADM76833.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015567|gb|ADM76837.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015569|gb|ADM76838.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015571|gb|ADM76839.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015573|gb|ADM76840.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015577|gb|ADM76842.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015579|gb|ADM76843.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015581|gb|ADM76844.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015583|gb|ADM76845.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015585|gb|ADM76846.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015587|gb|ADM76847.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015589|gb|ADM76848.1| auxin efflux carrier-like protein, partial [Picea sitchensis] gi|306015591|gb|ADM76849.1| auxin efflux carrier-like protein, partial [Picea sitchensis] Length = 193 Score = 73.2 bits (178), Expect = 3e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWIL 214 TM QLFNVGQ+ECSVLFLWTYL AA+A+T WSTV+MWIL Sbjct: 153 TMAQLFNVGQQECSVLFLWTYLLAAIAITFWSTVYMWIL 191 >ref|XP_002461853.1| hypothetical protein SORBIDRAFT_02g009270 [Sorghum bicolor] gi|241925230|gb|EER98374.1| hypothetical protein SORBIDRAFT_02g009270 [Sorghum bicolor] Length = 94 Score = 73.2 bits (178), Expect = 3e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWIL 214 TM+QL++VGQEECSV+ LWTYL AALALTVWST+FMWIL Sbjct: 55 TMSQLYDVGQEECSVILLWTYLVAALALTVWSTIFMWIL 93 >ref|XP_004159743.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis sativus] Length = 412 Score = 72.4 bits (176), Expect = 5e-11 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -1 Query: 330 TMTQLFNVGQEECSVLFLWTYLGAALALTVWSTVFMWILS 211 TMTQLF VGQEECSV+ LWTYL AAL+L +WS VFMWILS Sbjct: 373 TMTQLFGVGQEECSVIMLWTYLAAALSLALWSAVFMWILS 412