BLASTX nr result
ID: Jatropha_contig00044538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00044538 (328 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511150.1| metal ion binding protein, putative [Ricinus... 82 9e-14 gb|ESR50113.1| hypothetical protein CICLE_v10031989mg [Citrus cl... 75 8e-12 ref|XP_004145149.1| PREDICTED: uncharacterized protein LOC101222... 74 2e-11 ref|XP_004138039.1| PREDICTED: uncharacterized protein LOC101211... 70 2e-10 gb|ESW32008.1| hypothetical protein PHAVU_002G285600g [Phaseolus... 69 5e-10 gb|ADT78695.1| metal ion binding protein [Phaseolus vulgaris] gi... 69 5e-10 ref|XP_004297526.1| PREDICTED: uncharacterized protein LOC101297... 69 8e-10 ref|XP_006280892.1| hypothetical protein CARUB_v10026885mg [Caps... 68 1e-09 ref|XP_003532538.1| PREDICTED: uncharacterized protein LOC100796... 68 1e-09 ref|XP_002865821.1| hypothetical protein ARALYDRAFT_495136 [Arab... 68 1e-09 ref|NP_001119410.1| Heavy-metal-associated domain-containing pro... 67 3e-09 ref|NP_199887.2| Heavy-metal-associated domain-containing protei... 67 3e-09 dbj|BAD94944.1| putative protein [Arabidopsis thaliana] 67 3e-09 dbj|BAA96986.1| unnamed protein product [Arabidopsis thaliana] g... 67 3e-09 gb|ESQ43523.1| hypothetical protein EUTSA_v10016103mg [Eutrema s... 65 9e-09 ref|NP_001239647.1| uncharacterized protein LOC100808454 [Glycin... 65 1e-08 gb|EOY22529.1| Heavy metal transport/detoxification superfamily ... 64 3e-08 ref|XP_004503738.1| PREDICTED: translation initiation factor IF-... 59 6e-07 emb|CAB61745.1| farnesylated protein [Cicer arietinum] 59 6e-07 ref|XP_003523156.1| PREDICTED: uncharacterized protein LOC100787... 59 8e-07 >ref|XP_002511150.1| metal ion binding protein, putative [Ricinus communis] gi|223550265|gb|EEF51752.1| metal ion binding protein, putative [Ricinus communis] Length = 349 Score = 81.6 bits (200), Expect = 9e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 4 VVELKKNEYYYFPPRPYAMELYAYPPQIFSDENPNACSVM 123 V+ELKKNEYYY+PPR YAMELYAYPPQIFSDENPNACSVM Sbjct: 311 VIELKKNEYYYYPPR-YAMELYAYPPQIFSDENPNACSVM 349 >gb|ESR50113.1| hypothetical protein CICLE_v10031989mg [Citrus clementina] Length = 345 Score = 75.1 bits (183), Expect = 8e-12 Identities = 37/43 (86%), Positives = 39/43 (90%), Gaps = 2/43 (4%) Frame = +1 Query: 1 TVVELKKN--EYYYFPPRPYAMELYAYPPQIFSDENPNACSVM 123 TVVELKKN EYYY+P R YAME+YAYPPQIFSDENPNACSVM Sbjct: 304 TVVELKKNINEYYYYPQR-YAMEMYAYPPQIFSDENPNACSVM 345 >ref|XP_004145149.1| PREDICTED: uncharacterized protein LOC101222573 [Cucumis sativus] gi|449471026|ref|XP_004153186.1| PREDICTED: uncharacterized protein LOC101218262 [Cucumis sativus] Length = 333 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +1 Query: 4 VVELKKNEYYYFPPRPYAMELYAYPPQIFSDENPNACSVM 123 +VELKKNEYY P+ YAME+YAYPPQIFSDENPNACSVM Sbjct: 294 LVELKKNEYYQHYPQRYAMEMYAYPPQIFSDENPNACSVM 333 >ref|XP_004138039.1| PREDICTED: uncharacterized protein LOC101211886 [Cucumis sativus] Length = 314 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = +1 Query: 4 VVELKKNEYYYFPPRPYAMELYAYPPQIFSDENPNACSVM 123 +VE+KKNEY+Y+P R Y ME+YAYPPQ+FSDENPNACS+M Sbjct: 276 MVEVKKNEYHYYPQR-YIMEMYAYPPQMFSDENPNACSIM 314 >gb|ESW32008.1| hypothetical protein PHAVU_002G285600g [Phaseolus vulgaris] Length = 313 Score = 69.3 bits (168), Expect = 5e-10 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 5/46 (10%) Frame = +1 Query: 1 TVVELKKNEYYYFPPRPYAMELYAYP-----PQIFSDENPNACSVM 123 TVVEL+K+EYYY PPR Y ME YAYP PQIFSDENPNACSVM Sbjct: 269 TVVELRKSEYYYNPPR-YGMEFYAYPGPAYPPQIFSDENPNACSVM 313 >gb|ADT78695.1| metal ion binding protein [Phaseolus vulgaris] gi|543177137|gb|AGV54590.1| metal ion binding [Phaseolus vulgaris] Length = 314 Score = 69.3 bits (168), Expect = 5e-10 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 5/46 (10%) Frame = +1 Query: 1 TVVELKKNEYYYFPPRPYAMELYAYP-----PQIFSDENPNACSVM 123 TVVEL+K+EYYY PPR Y ME YAYP PQIFSDENPNACSVM Sbjct: 270 TVVELRKSEYYYNPPR-YGMEFYAYPGPAYPPQIFSDENPNACSVM 314 >ref|XP_004297526.1| PREDICTED: uncharacterized protein LOC101297429 [Fragaria vesca subsp. vesca] Length = 348 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 13 LKKNEYYYFPPRPYAMELYAYPPQIFSDENPNACSVM 123 +K NEY Y+PPR YAMELYAYPPQIFSDENPNAC+VM Sbjct: 313 MKINEYNYYPPR-YAMELYAYPPQIFSDENPNACAVM 348 >ref|XP_006280892.1| hypothetical protein CARUB_v10026885mg [Capsella rubella] gi|482549596|gb|EOA13790.1| hypothetical protein CARUB_v10026885mg [Capsella rubella] Length = 295 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +1 Query: 4 VVELKKNEYYYFPPRPYAMELYAYPPQIFSDENPNACSVM 123 VV+LKKNEY Y PPR Y +E++AYPPQIFSDENPNAC++M Sbjct: 257 VVDLKKNEYQYQPPR-YPVEMFAYPPQIFSDENPNACTIM 295 >ref|XP_003532538.1| PREDICTED: uncharacterized protein LOC100796289 [Glycine max] Length = 310 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/46 (71%), Positives = 35/46 (76%), Gaps = 6/46 (13%) Frame = +1 Query: 4 VVELKKNEYYYFPPRPYAMELYA------YPPQIFSDENPNACSVM 123 V+ELKK+EYYY PP Y ME YA YPPQIFSDENPNACSVM Sbjct: 265 VLELKKSEYYYNPPPRYGMEFYASYPGPSYPPQIFSDENPNACSVM 310 >ref|XP_002865821.1| hypothetical protein ARALYDRAFT_495136 [Arabidopsis lyrata subsp. lyrata] gi|297311656|gb|EFH42080.1| hypothetical protein ARALYDRAFT_495136 [Arabidopsis lyrata subsp. lyrata] Length = 284 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +1 Query: 4 VVELKKNEYYYFPPRPYAMELYAYPPQIFSDENPNACSVM 123 VV+LKKNEY Y PPR Y +E++AYPPQIFSDENPNAC++M Sbjct: 246 VVDLKKNEYQYQPPR-YPVEMFAYPPQIFSDENPNACTIM 284 >ref|NP_001119410.1| Heavy-metal-associated domain-containing protein [Arabidopsis thaliana] gi|332008603|gb|AED95986.1| Heavy-metal-associated domain-containing protein [Arabidopsis thaliana] Length = 290 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = +1 Query: 4 VVELKKNEYYYFPPRPYAMELYAYPPQIFSDENPNACSVM 123 VV+LKKNEY Y PPR Y +E++AYPPQIFSDENPNAC+++ Sbjct: 252 VVDLKKNEYQYQPPR-YPVEMFAYPPQIFSDENPNACTII 290 >ref|NP_199887.2| Heavy-metal-associated domain-containing protein [Arabidopsis thaliana] gi|332008601|gb|AED95984.1| Heavy-metal-associated domain-containing protein [Arabidopsis thaliana] Length = 283 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = +1 Query: 4 VVELKKNEYYYFPPRPYAMELYAYPPQIFSDENPNACSVM 123 VV+LKKNEY Y PPR Y +E++AYPPQIFSDENPNAC+++ Sbjct: 245 VVDLKKNEYQYQPPR-YPVEMFAYPPQIFSDENPNACTII 283 >dbj|BAD94944.1| putative protein [Arabidopsis thaliana] Length = 283 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = +1 Query: 4 VVELKKNEYYYFPPRPYAMELYAYPPQIFSDENPNACSVM 123 VV+LKKNEY Y PPR Y +E++AYPPQIFSDENPNAC+++ Sbjct: 245 VVDLKKNEYQYQPPR-YPVEMFAYPPQIFSDENPNACTII 283 >dbj|BAA96986.1| unnamed protein product [Arabidopsis thaliana] gi|117168141|gb|ABK32153.1| At5g50730 [Arabidopsis thaliana] Length = 139 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = +1 Query: 4 VVELKKNEYYYFPPRPYAMELYAYPPQIFSDENPNACSVM 123 VV+LKKNEY Y PPR Y +E++AYPPQIFSDENPNAC+++ Sbjct: 101 VVDLKKNEYQYQPPR-YPVEMFAYPPQIFSDENPNACTII 139 >gb|ESQ43523.1| hypothetical protein EUTSA_v10016103mg [Eutrema salsugineum] Length = 253 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 7 VELKKNEYYYFPPRPYAMELYAYPPQIFSDENPNACSVM 123 V+LKKNEY Y PPR Y +E++ YPPQIFSDENPNAC++M Sbjct: 216 VDLKKNEYQYQPPR-YPVEMFTYPPQIFSDENPNACTIM 253 >ref|NP_001239647.1| uncharacterized protein LOC100808454 [Glycine max] gi|255636041|gb|ACU18365.1| unknown [Glycine max] Length = 308 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/47 (70%), Positives = 36/47 (76%), Gaps = 6/47 (12%) Frame = +1 Query: 1 TVVELKKNEYYYFPPRPYA-MELYAY-----PPQIFSDENPNACSVM 123 TV+E+KK+EYYY PP Y ME YAY PPQIFSDENPNACSVM Sbjct: 262 TVLEVKKSEYYYNPPPRYGGMEFYAYSGPAYPPQIFSDENPNACSVM 308 >gb|EOY22529.1| Heavy metal transport/detoxification superfamily protein, putative [Theobroma cacao] Length = 363 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 7 VELKKNEYYYFPPRPYAMELYAYPPQIFSDENPNACSVM 123 VEL++NEYY +PPR YA E YAYP QIFSDENPNACSVM Sbjct: 327 VELRRNEYYSYPPR-YATEFYAYP-QIFSDENPNACSVM 363 >ref|XP_004503738.1| PREDICTED: translation initiation factor IF-2-like [Cicer arietinum] gi|502139362|ref|XP_004503739.1| PREDICTED: translation initiation factor IF-2-like [Cicer arietinum] Length = 324 Score = 58.9 bits (141), Expect = 6e-07 Identities = 30/48 (62%), Positives = 34/48 (70%), Gaps = 8/48 (16%) Frame = +1 Query: 4 VVELKKNEYYY--------FPPRPYAMELYAYPPQIFSDENPNACSVM 123 VVE+KKNEYYY +P Y ++ AYPPQIFSDENPNACSVM Sbjct: 279 VVEMKKNEYYYKYGTEVFAYPDPAYPLQ--AYPPQIFSDENPNACSVM 324 >emb|CAB61745.1| farnesylated protein [Cicer arietinum] Length = 101 Score = 58.9 bits (141), Expect = 6e-07 Identities = 30/48 (62%), Positives = 34/48 (70%), Gaps = 8/48 (16%) Frame = +1 Query: 4 VVELKKNEYYY--------FPPRPYAMELYAYPPQIFSDENPNACSVM 123 VVE+KKNEYYY +P Y ++ AYPPQIFSDENPNACSVM Sbjct: 56 VVEMKKNEYYYKYGTEVFAYPDPAYPLQ--AYPPQIFSDENPNACSVM 101 >ref|XP_003523156.1| PREDICTED: uncharacterized protein LOC100787932 [Glycine max] Length = 319 Score = 58.5 bits (140), Expect = 8e-07 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 10/50 (20%) Frame = +1 Query: 4 VVELKKNEYYYFPPRPYAMELYAYP----------PQIFSDENPNACSVM 123 V E+K NEY+Y PPR Y ME+YAYP PQ+FSDENPNAC+VM Sbjct: 271 VPEVKINEYFYNPPR-YGMEVYAYPAHPAYFHSYPPQMFSDENPNACTVM 319