BLASTX nr result
ID: Jatropha_contig00044432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00044432 (379 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525831.1| 40S ribosomal protein S6, putative [Ricinus ... 70 9e-14 gb|ESR39582.1| hypothetical protein CICLE_v10026340mg [Citrus cl... 70 1e-13 gb|ESR34413.1| hypothetical protein CICLE_v10005711mg [Citrus cl... 69 3e-13 gb|EOX92032.1| Ribosomal protein S6e isoform 3 [Theobroma cacao] 68 3e-13 gb|EOX92030.1| Ribosomal protein S6e isoform 1 [Theobroma cacao]... 68 3e-13 gb|ERN04110.1| hypothetical protein AMTR_s00077p00035710 [Ambore... 69 3e-13 ref|XP_004133785.1| PREDICTED: 40S ribosomal protein S6-like [Cu... 69 4e-13 gb|EEE81580.2| hypothetical protein POPTR_0002s09970g [Populus t... 69 4e-13 ref|XP_002300192.1| predicted protein [Populus trichocarpa] gi|1... 69 4e-13 gb|ADU04154.1| hypothetical protein [Gossypium hirsutum] 68 7e-13 ref|XP_002271632.1| PREDICTED: 40S ribosomal protein S6 isoform ... 69 9e-13 ref|XP_002285752.1| PREDICTED: 40S ribosomal protein S6 [Vitis v... 69 9e-13 gb|EMJ28749.1| hypothetical protein PRUPE_ppa010452mg [Prunus pe... 67 9e-13 ref|XP_004152628.1| PREDICTED: 40S ribosomal protein S6-like [Cu... 67 9e-13 ref|XP_002309965.1| predicted protein [Populus trichocarpa] gi|2... 67 9e-13 ref|XP_002306298.1| predicted protein [Populus trichocarpa] gi|1... 67 9e-13 gb|ERN15502.1| hypothetical protein AMTR_s00048p00058600 [Ambore... 69 1e-12 ref|XP_004253069.1| PREDICTED: 40S ribosomal protein S6-like [So... 69 1e-12 ref|XP_006342473.1| PREDICTED: 40S ribosomal protein S6-1-like [... 69 1e-12 ref|XP_002302307.1| predicted protein [Populus trichocarpa] 69 1e-12 >ref|XP_002525831.1| 40S ribosomal protein S6, putative [Ricinus communis] gi|223534836|gb|EEF36525.1| 40S ribosomal protein S6, putative [Ricinus communis] Length = 197 Score = 70.1 bits (170), Expect(2) = 9e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPS+AA Sbjct: 161 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIAA 197 Score = 32.0 bits (71), Expect(2) = 9e-14 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTPKNTSAETC*DCRQKEENCKGQGRGS 244 G+KV++APKIQRLVTP + ++K+ K + + Sbjct: 119 GKKVSKAPKIQRLVTPLTLQRKRARIAQKKQRIAKAKSEAA 159 >gb|ESR39582.1| hypothetical protein CICLE_v10026340mg [Citrus clementina] Length = 249 Score = 70.1 bits (170), Expect(2) = 1e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPS+AA Sbjct: 213 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 Score = 31.6 bits (70), Expect(2) = 1e-13 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTPKNTSAETC*DCRQKEENCKGQGRGS 244 G+KV++APKIQRLVTP + +K+ K + + Sbjct: 171 GKKVSKAPKIQRLVTPLTLQRKRARIAEKKQRIAKAKAEAA 211 >gb|ESR34413.1| hypothetical protein CICLE_v10005711mg [Citrus clementina] Length = 250 Score = 68.9 bits (167), Expect(2) = 3e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPS AA Sbjct: 213 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSTAA 249 Score = 31.6 bits (70), Expect(2) = 3e-13 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTPKNTSAETC*DCRQKEENCKGQGRGS 244 G+KV++APKIQRLVTP + +K+ K + + Sbjct: 171 GKKVSKAPKIQRLVTPLTLQRKRARIAEKKQRIAKAKAEAA 211 >gb|EOX92032.1| Ribosomal protein S6e isoform 3 [Theobroma cacao] Length = 250 Score = 68.2 bits (165), Expect(2) = 3e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLA RLKEQRERRSESLAKKRSRLSAASKPSVAA Sbjct: 214 YQKLLAQRLKEQRERRSESLAKKRSRLSAASKPSVAA 250 Score = 32.3 bits (72), Expect(2) = 3e-13 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -2 Query: 378 NKGGGRKVTQAPKIQRLVTP 319 N G+KV++APKIQRLVTP Sbjct: 168 NTKSGKKVSKAPKIQRLVTP 187 >gb|EOX92030.1| Ribosomal protein S6e isoform 1 [Theobroma cacao] gi|508700135|gb|EOX92031.1| Ribosomal protein S6e isoform 1 [Theobroma cacao] Length = 249 Score = 68.2 bits (165), Expect(2) = 3e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLA RLKEQRERRSESLAKKRSRLSAASKPSVAA Sbjct: 213 YQKLLAQRLKEQRERRSESLAKKRSRLSAASKPSVAA 249 Score = 32.3 bits (72), Expect(2) = 3e-13 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -2 Query: 378 NKGGGRKVTQAPKIQRLVTP 319 N G+KV++APKIQRLVTP Sbjct: 167 NTKSGKKVSKAPKIQRLVTP 186 >gb|ERN04110.1| hypothetical protein AMTR_s00077p00035710 [Amborella trichopoda] Length = 249 Score = 68.9 bits (167), Expect(2) = 3e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLA+RLKEQRERRSESLAKKRSRLSAASKPSVAA Sbjct: 213 YQKLLASRLKEQRERRSESLAKKRSRLSAASKPSVAA 249 Score = 31.2 bits (69), Expect(2) = 3e-13 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTP 319 G+KV++APKIQRLVTP Sbjct: 171 GKKVSKAPKIQRLVTP 186 >ref|XP_004133785.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis sativus] gi|449477988|ref|XP_004155185.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis sativus] Length = 250 Score = 68.6 bits (166), Expect(2) = 4e-13 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLA+RLKEQRERRSESLAKKRSRLSAASKPS+AA Sbjct: 213 YQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 Score = 31.2 bits (69), Expect(2) = 4e-13 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTP 319 G+KV++APKIQRLVTP Sbjct: 171 GKKVSKAPKIQRLVTP 186 >gb|EEE81580.2| hypothetical protein POPTR_0002s09970g [Populus trichocarpa] Length = 249 Score = 68.6 bits (166), Expect(2) = 4e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLATRLKEQRERRSESLAKKRSRLS ASKPS+AA Sbjct: 213 YQKLLATRLKEQRERRSESLAKKRSRLSVASKPSIAA 249 Score = 31.2 bits (69), Expect(2) = 4e-13 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTP 319 G+KV++APKIQRLVTP Sbjct: 171 GKKVSKAPKIQRLVTP 186 >ref|XP_002300192.1| predicted protein [Populus trichocarpa] gi|118482123|gb|ABK92992.1| unknown [Populus trichocarpa] gi|222847450|gb|EEE84997.1| hypothetical protein POPTR_0001s31850g [Populus trichocarpa] Length = 249 Score = 68.6 bits (166), Expect(2) = 4e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLATRLKEQRERRSESLAKKRSRLS ASKPSVAA Sbjct: 213 YQKLLATRLKEQRERRSESLAKKRSRLSIASKPSVAA 249 Score = 31.2 bits (69), Expect(2) = 4e-13 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTP 319 G+KV++APKIQRLVTP Sbjct: 171 GKKVSKAPKIQRLVTP 186 >gb|ADU04154.1| hypothetical protein [Gossypium hirsutum] Length = 249 Score = 67.8 bits (164), Expect(2) = 7e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLA RLKEQRERRSESLAKKRSRLSAASKPS+AA Sbjct: 213 YQKLLAQRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 Score = 31.2 bits (69), Expect(2) = 7e-13 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTP 319 G+KV++APKIQRLVTP Sbjct: 171 GKKVSKAPKIQRLVTP 186 >ref|XP_002271632.1| PREDICTED: 40S ribosomal protein S6 isoform 1 [Vitis vinifera] gi|296087487|emb|CBI34076.3| unnamed protein product [Vitis vinifera] Length = 249 Score = 69.3 bits (168), Expect(2) = 9e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLATRLKEQRERRSESLAK+RSRLSAASKPSVAA Sbjct: 213 YQKLLATRLKEQRERRSESLAKRRSRLSAASKPSVAA 249 Score = 29.3 bits (64), Expect(2) = 9e-13 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTP 319 G+K ++APKIQRLVTP Sbjct: 171 GKKCSKAPKIQRLVTP 186 >ref|XP_002285752.1| PREDICTED: 40S ribosomal protein S6 [Vitis vinifera] gi|302141988|emb|CBI19191.3| unnamed protein product [Vitis vinifera] Length = 249 Score = 69.3 bits (168), Expect(2) = 9e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLATRLKEQRERRSESLAK+RSRLSAASKPSVAA Sbjct: 213 YQKLLATRLKEQRERRSESLAKRRSRLSAASKPSVAA 249 Score = 29.3 bits (64), Expect(2) = 9e-13 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTP 319 G+K ++APKIQRLVTP Sbjct: 171 GKKCSKAPKIQRLVTP 186 >gb|EMJ28749.1| hypothetical protein PRUPE_ppa010452mg [Prunus persica] Length = 249 Score = 67.4 bits (163), Expect(2) = 9e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLA+RLKEQR+RRSESLAKKRSRLSAASKPS+AA Sbjct: 213 YQKLLASRLKEQRDRRSESLAKKRSRLSAASKPSIAA 249 Score = 31.2 bits (69), Expect(2) = 9e-13 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTP 319 G+KV++APKIQRLVTP Sbjct: 171 GKKVSKAPKIQRLVTP 186 >ref|XP_004152628.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis sativus] gi|449523798|ref|XP_004168910.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis sativus] Length = 249 Score = 67.4 bits (163), Expect(2) = 9e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLL++RLKEQRERRSESLAKKRSRLSAASKPS+AA Sbjct: 213 YQKLLSSRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 Score = 31.2 bits (69), Expect(2) = 9e-13 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTP 319 G+KV++APKIQRLVTP Sbjct: 171 GKKVSKAPKIQRLVTP 186 >ref|XP_002309965.1| predicted protein [Populus trichocarpa] gi|222852868|gb|EEE90415.1| hypothetical protein POPTR_0007s05090g [Populus trichocarpa] Length = 249 Score = 67.4 bits (163), Expect(2) = 9e-13 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLATRLKEQRERRSESLAKKRSRLS ASKPSV A Sbjct: 213 YQKLLATRLKEQRERRSESLAKKRSRLSVASKPSVVA 249 Score = 31.2 bits (69), Expect(2) = 9e-13 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTP 319 G+KV++APKIQRLVTP Sbjct: 171 GKKVSKAPKIQRLVTP 186 >ref|XP_002306298.1| predicted protein [Populus trichocarpa] gi|118485704|gb|ABK94702.1| unknown [Populus trichocarpa] gi|222855747|gb|EEE93294.1| hypothetical protein POPTR_0005s07380g [Populus trichocarpa] gi|550338324|gb|ERP60691.1| hypothetical protein POPTR_0005s07380g [Populus trichocarpa] Length = 249 Score = 67.4 bits (163), Expect(2) = 9e-13 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLATRLKEQRERRSESLAKKRSRLS ASKPSV A Sbjct: 213 YQKLLATRLKEQRERRSESLAKKRSRLSVASKPSVVA 249 Score = 31.2 bits (69), Expect(2) = 9e-13 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTP 319 G+KV++APKIQRLVTP Sbjct: 171 GKKVSKAPKIQRLVTP 186 >gb|ERN15502.1| hypothetical protein AMTR_s00048p00058600 [Amborella trichopoda] Length = 249 Score = 68.9 bits (167), Expect(2) = 1e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLA+RLKEQRERRSESLAKKRSRLSAASKPSVAA Sbjct: 213 YQKLLASRLKEQRERRSESLAKKRSRLSAASKPSVAA 249 Score = 29.3 bits (64), Expect(2) = 1e-12 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTP 319 G+K ++APKIQRLVTP Sbjct: 171 GKKCSKAPKIQRLVTP 186 >ref|XP_004253069.1| PREDICTED: 40S ribosomal protein S6-like [Solanum lycopersicum] Length = 249 Score = 68.6 bits (166), Expect(2) = 1e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLA+RLKEQRERRSESLAKKRSRLSAASKPS+AA Sbjct: 213 YQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 Score = 29.6 bits (65), Expect(2) = 1e-12 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTP 319 G++V++APKIQRLVTP Sbjct: 171 GKEVSKAPKIQRLVTP 186 >ref|XP_006342473.1| PREDICTED: 40S ribosomal protein S6-1-like [Solanum tuberosum] gi|76161014|gb|ABA40470.1| ribosomal protein S6-like protein [Solanum tuberosum] Length = 249 Score = 68.6 bits (166), Expect(2) = 1e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLA+RLKEQRERRSESLAKKRSRLSAASKPS+AA Sbjct: 213 YQKLLASRLKEQRERRSESLAKKRSRLSAASKPSIAA 249 Score = 29.6 bits (65), Expect(2) = 1e-12 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTP 319 G++V++APKIQRLVTP Sbjct: 171 GKEVSKAPKIQRLVTP 186 >ref|XP_002302307.1| predicted protein [Populus trichocarpa] Length = 249 Score = 68.6 bits (166), Expect(2) = 1e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 239 YQKLLATRLKEQRERRSESLAKKRSRLSAASKPSVAA 129 YQKLLATRLKEQRERRSESLAKKRSRLS ASKPS+AA Sbjct: 213 YQKLLATRLKEQRERRSESLAKKRSRLSVASKPSIAA 249 Score = 29.6 bits (65), Expect(2) = 1e-12 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -2 Query: 366 GRKVTQAPKIQRLVTP 319 G+KV++ PKIQRLVTP Sbjct: 171 GKKVSKGPKIQRLVTP 186