BLASTX nr result
ID: Jatropha_contig00044172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00044172 (278 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP61464.1| hypothetical protein POPTR_0005s23390g [Populus t... 70 4e-10 ref|XP_002524752.1| nucleolar protein nop56, putative [Ricinus c... 70 4e-10 emb|CBI28721.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_003632318.1| PREDICTED: vicilin-like antimicrobial peptid... 67 2e-09 emb|CBI28722.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|XP_003632338.1| PREDICTED: vicilin-like antimicrobial peptid... 60 4e-07 gb|AAM73730.2|AF395894_1 vicilin-like protein [Anacardium occide... 58 1e-06 gb|AAM73729.1|AF395893_1 vicilin-like protein [Anacardium occide... 58 1e-06 gb|ABO36677.1| vicilin [Pistacia vera] 57 2e-06 gb|AAL86739.1|AF441864_1 48-kDa glycoprotein precursor [Corylus ... 57 3e-06 ref|XP_004162195.1| PREDICTED: vicilin-like antimicrobial peptid... 56 5e-06 ref|XP_004146991.1| PREDICTED: vicilin-like antimicrobial peptid... 56 5e-06 >gb|ERP61464.1| hypothetical protein POPTR_0005s23390g [Populus trichocarpa] gi|550339592|gb|EEE93780.2| hypothetical protein POPTR_0005s23390g [Populus trichocarpa] Length = 544 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = +1 Query: 1 GKNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRGSFEGHAVA 156 GK N++ +M+++AKELA+GV +EVDQ FG+Q EE+FFPGPRR EG A A Sbjct: 493 GKWNVIGEMDREAKELAYGVPAKEVDQIFGKQQEEFFFPGPRRQRREGRAYA 544 >ref|XP_002524752.1| nucleolar protein nop56, putative [Ricinus communis] gi|223535936|gb|EEF37595.1| nucleolar protein nop56, putative [Ricinus communis] Length = 560 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/52 (61%), Positives = 40/52 (76%) Frame = +1 Query: 1 GKNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRGSFEGHAVA 156 G+NNIV + E++AKELAFGV REVD+ F QNE +FFPGPRR ++G A A Sbjct: 509 GRNNIVRRWEREAKELAFGVRAREVDEVFESQNEVFFFPGPRRQEWQGRASA 560 >emb|CBI28721.3| unnamed protein product [Vitis vinifera] Length = 399 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 1 GKNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRG 132 G NIVN +EK+AKELAF + REVD+ F +QNE WFFPGPR G Sbjct: 352 GDKNIVNALEKEAKELAFSIPAREVDEVFAKQNEWWFFPGPRGG 395 >ref|XP_003632318.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Vitis vinifera] Length = 562 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 1 GKNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRG 132 G NIVN +EK+AKELAF + REVD+ F +QNE WFFPGPR G Sbjct: 515 GDKNIVNALEKEAKELAFSIPAREVDEVFAKQNEWWFFPGPRGG 558 >emb|CBI28722.3| unnamed protein product [Vitis vinifera] Length = 1361 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = +1 Query: 1 GKNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRGSFEGH 147 GK N+VN +EK+AKELAF + REVD+ F +Q EE FFPGP+ + H Sbjct: 520 GKGNVVNGLEKEAKELAFALPAREVDKVFRKQKEELFFPGPQLQKQQHH 568 >ref|XP_003632338.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Vitis vinifera] Length = 520 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = +1 Query: 1 GKNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRGSFEGH 147 GK N+VN +EK+AKELAF + REVD+ F +Q EE FFPGP+ + H Sbjct: 463 GKGNVVNGLEKEAKELAFALPAREVDKVFRKQKEELFFPGPQLQKQQHH 511 >gb|AAM73730.2|AF395894_1 vicilin-like protein [Anacardium occidentale] Length = 538 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/51 (56%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = +1 Query: 1 GKNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPR-RGSFEGHA 150 GK NI+ MEK+AKELAF + EVD+ FG+Q+EE+FF GP R EG A Sbjct: 486 GKKNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRA 536 >gb|AAM73729.1|AF395893_1 vicilin-like protein [Anacardium occidentale] Length = 536 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/51 (56%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = +1 Query: 1 GKNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPR-RGSFEGHA 150 GK NI+ MEK+AKELAF + EVD+ FG+Q+EE+FF GP R EG A Sbjct: 484 GKKNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRA 534 >gb|ABO36677.1| vicilin [Pistacia vera] Length = 519 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +1 Query: 1 GKNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPR 126 GK NI+ MEK+AKELAF EVD+ FG+Q+EE+FF GP+ Sbjct: 467 GKKNIIEVMEKEAKELAFKTKGEEVDKVFGKQDEEFFFQGPK 508 >gb|AAL86739.1|AF441864_1 48-kDa glycoprotein precursor [Corylus avellana] Length = 448 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = +1 Query: 1 GKNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRGSFEG 144 GK NIVN+ E+ AKELAF + REV++ F Q++ +FFPGP + EG Sbjct: 393 GKGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEG 440 >ref|XP_004162195.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Cucumis sativus] Length = 453 Score = 55.8 bits (133), Expect = 5e-06 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = +1 Query: 1 GKNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRGSFE 141 GK NIVNKME A+EL F REV++ F +Q EE+FFPGP + E Sbjct: 403 GKENIVNKMESIARELGFNTPGREVERMFKQQEEEFFFPGPNQQEHE 449 >ref|XP_004146991.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Cucumis sativus] Length = 453 Score = 55.8 bits (133), Expect = 5e-06 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = +1 Query: 1 GKNNIVNKMEKQAKELAFGVSEREVDQAFGRQNEEWFFPGPRRGSFE 141 GK NIVNKME A+EL F REV++ F +Q EE+FFPGP + E Sbjct: 403 GKENIVNKMESIARELGFNTPGREVERMFKQQEEEFFFPGPNQQEHE 449