BLASTX nr result
ID: Jatropha_contig00044067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00044067 (515 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF00849.2| hypothetical protein POPTR_0010s09410g [Populus t... 60 4e-07 ref|XP_002517094.1| pentatricopeptide repeat-containing protein,... 59 5e-07 ref|XP_002517095.1| ATP-dependent RNA and DNA helicase, putative... 57 2e-06 >gb|EEF00849.2| hypothetical protein POPTR_0010s09410g [Populus trichocarpa] Length = 553 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -2 Query: 514 LKGMVPKYDTYKMLVQELEQRNMIEAKEKIEKLMFQAEEPQL 389 LKGMVP T+K LV+ELEQ+NM E KEKIEKLMFQA E L Sbjct: 511 LKGMVPMVKTFKALVEELEQKNMKEMKEKIEKLMFQARERNL 552 >ref|XP_002517094.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543729|gb|EEF45257.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 549 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -2 Query: 514 LKGMVPKYDTYKMLVQELEQRNMIEAKEKIEKLMFQAEE 398 +KG++P+ TYKMLV+ELEQ N+ EAKEKI+KLMFQ E+ Sbjct: 507 MKGLIPRDRTYKMLVEELEQNNLTEAKEKIQKLMFQTED 545 >ref|XP_002517095.1| ATP-dependent RNA and DNA helicase, putative [Ricinus communis] gi|223543730|gb|EEF45258.1| ATP-dependent RNA and DNA helicase, putative [Ricinus communis] Length = 547 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/48 (54%), Positives = 29/48 (60%) Frame = -2 Query: 145 AGNLGPYQSRVELKVGGLVGVHNMLREYSSGNATVKIDFTDLSCPHSW 2 A N P+Q E K G L VH + R Y S N KIDFTDL+CPHSW Sbjct: 24 AENGEPFQLHAEFKFGALFSVHTLTRLYRSDNGKPKIDFTDLTCPHSW 71