BLASTX nr result
ID: Jatropha_contig00044053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00044053 (367 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512549.1| Auxin-induced protein 5NG4, putative [Ricinu... 65 9e-09 >ref|XP_002512549.1| Auxin-induced protein 5NG4, putative [Ricinus communis] gi|223548510|gb|EEF50001.1| Auxin-induced protein 5NG4, putative [Ricinus communis] Length = 370 Score = 65.1 bits (157), Expect = 9e-09 Identities = 35/51 (68%), Positives = 38/51 (74%), Gaps = 6/51 (11%) Frame = +1 Query: 1 VDGLYAVLWGKDKEMKLKVIEEIEARKQ------NNDLELQLPAKSNGTYG 135 V GLYAVLWGKDKEMK+K IE+IEA KQ DLELQLPA SNG+ G Sbjct: 317 VAGLYAVLWGKDKEMKMKGIEDIEAIKQGGGKEERGDLELQLPANSNGSNG 367